Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PTPRN, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q16849
Molecular weight:
21.96 kDa

Original price was: $356.00.Current price is: $274.00.

50ug 23% OFF + 274 loyalty points
Met389–Arg575
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PTPRN, N-His

Product name ARO-P13319-100
Uniprot ID Q16849
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEGPVEGRDTAELPARTSPMPGHPTASPTSSEVQQVPSPVSSEPPKAARPPVTPVLLEKKSPLGQSQPTVAGQPSARPAAEEYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQREEAAAVLPQTAHSTSPMR
Molecular weight 21.96 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met389-Arg575
Aliases /Synonyms ICA512-TMF, ICA512-CCF, Receptor-type tyrosine-protein phosphatase-like N, Islet cell autoantigen 3, ICA512, PTPRN, Islet cell antigen 512, ICA 512, PTP IA-2, ICA3, ICA512-NTF, R-PTP-N
Reference ARO-P13319
Note For research use only.
Molecular Constructor
Met389–Arg575
Product name ARO-P13319-1MG
Uniprot ID Q16849
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEGPVEGRDTAELPARTSPMPGHPTASPTSSEVQQVPSPVSSEPPKAARPPVTPVLLEKKSPLGQSQPTVAGQPSARPAAEEYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQREEAAAVLPQTAHSTSPMR
Molecular weight 21.96 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met389-Arg575
Aliases /Synonyms ICA512-TMF, ICA512-CCF, Receptor-type tyrosine-protein phosphatase-like N, Islet cell autoantigen 3, ICA512, PTPRN, Islet cell antigen 512, ICA 512, PTP IA-2, ICA3, ICA512-NTF, R-PTP-N
Reference ARO-P13319
Note For research use only.
Molecular Constructor
Met389–Arg575
Product name ARO-P13319-50
Uniprot ID Q16849
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MEGPVEGRDTAELPARTSPMPGHPTASPTSSEVQQVPSPVSSEPPKAARPPVTPVLLEKKSPLGQSQPTVAGQPSARPAAEEYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQREEAAAVLPQTAHSTSPMR
Molecular weight 21.96 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met389-Arg575
Aliases /Synonyms ICA512-TMF, ICA512-CCF, Receptor-type tyrosine-protein phosphatase-like N, Islet cell autoantigen 3, ICA512, PTPRN, Islet cell antigen 512, ICA 512, PTP IA-2, ICA3, ICA512-NTF, R-PTP-N
Reference ARO-P13319
Note For research use only.
Molecular Constructor
Met389–Arg575

Introduction to Recombinant Human PTPRN

Recombinant Human PTPRN, also known as protein tyrosine phosphatase receptor type N, is a recombinant protein that has been produced through genetic engineering techniques. This protein plays a crucial role in regulating cellular signaling pathways by dephosphorylating tyrosine residues on target proteins. It is a member of the protein tyrosine phosphatase (PTP) family and is highly expressed in the brain, pancreas, and liver.

Structure of Recombinant Human PTPRN

Recombinant Human PTPRN is a 923 amino acid protein with a molecular weight of approximately 105 kDa. It consists of a single catalytic domain, a transmembrane domain, and a cytoplasmic domain. The catalytic domain contains a conserved cysteine residue that is essential for its phosphatase activity. The transmembrane domain anchors the protein to the cell membrane, while the cytoplasmic domain contains regulatory motifs that control its activity.

Activity of Recombinant Human PTPRN

Recombinant Human PTPRN is a phosphatase enzyme that specifically dephosphorylates tyrosine residues on target proteins. It plays a crucial role in regulating various cellular processes such as cell growth, differentiation, and survival. This protein is involved in the regulation of insulin signaling, which is essential for maintaining glucose homeostasis. It also plays a role in neuronal development and synaptic plasticity, making it a potential target for neurological disorders.

The activity of Recombinant Human PTPRN is tightly regulated by various mechanisms. It can be activated by binding to its ligand, pleiotrophin, or through phosphorylation of its regulatory motifs. On the other hand, it can be inhibited by interacting with other proteins or through oxidation of its catalytic cysteine residue.

Application of Recombinant Human PTPRN

Recombinant Human PTPRN has various applications in both research and therapeutic fields. Its role in regulating insulin signaling makes it a potential target for the treatment of diabetes. In addition, its involvement in neurological disorders such as Alzheimer’s disease and Parkinson’s disease makes it a potential therapeutic target for these conditions.

In research, Recombinant Human PTPRN is widely used as a tool to study cellular signaling pathways. Its phosphatase activity allows researchers to investigate the role of tyrosine phosphorylation in various cellular processes. It is also used in drug discovery and development, as it can be used to screen for potential inhibitors of its activity.

Furthermore, Recombinant Human PTPRN is also used in diagnostic assays for various diseases. Its expression levels have been found to be altered in certain cancers, making it a potential biomarker for cancer diagnosis and prognosis.

Conclusion

Recombinant Human PTPRN is a crucial protein involved in regulating cellular signaling pathways. Its structure, activity, and applications make it a valuable tool for both research and therapeutic purposes. Further studies on this protein may lead to the development of novel treatments for various diseases, making it an important area of research in the field of biotechnology.

Recombinant Human PTPRN, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PTPRN, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products