Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human QKI Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96PU8
Molecular weight:
23.86 kDa

Original price was: $282.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Thr14–Gly202
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human QKI Protein, N-His

Product name ARO-P12272-100
Uniprot ID Q96PU8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNG
Molecular weight 23.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr14-Gly202
Aliases /Synonyms QKI, HqkI, HKQ, Hqk, Protein quaking
Reference ARO-P12272
Note For research use only.
Molecular Constructor
Thr14–Gly202
Product name ARO-P12272-1MG
Uniprot ID Q96PU8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNG
Molecular weight 23.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr14-Gly202
Aliases /Synonyms QKI, HqkI, HKQ, Hqk, Protein quaking
Reference ARO-P12272
Note For research use only.
Molecular Constructor
Thr14–Gly202
Product name ARO-P12272-50
Uniprot ID Q96PU8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNG
Molecular weight 23.86 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr14-Gly202
Aliases /Synonyms QKI, HqkI, HKQ, Hqk, Protein quaking
Reference ARO-P12272
Note For research use only.
Molecular Constructor
Thr14–Gly202

Introduction

Recombinant Human QKI Protein, also known as Quaking protein, is a member of the STAR (signal transduction and activation of RNA) family of RNA-binding proteins. It plays a crucial role in the regulation of RNA processing, stability, and translation, making it a vital protein in various biological processes.

Structure of Recombinant Human QKI Protein

Recombinant Human QKI Protein is a 378 amino acid protein with a molecular weight of approximately 42 kDa. It is composed of three main domains: an N-terminal STAR domain, a central KH domain, and a C-terminal QUA1 domain. The STAR domain is responsible for binding to RNA, while the KH domain is involved in protein-protein interactions. The QUA1 domain is responsible for the protein’s oligomerization, which is crucial for its function.

Activity of Recombinant Human QKI Protein

Recombinant Human QKI Protein is an RNA-binding protein that plays a crucial role in regulating RNA processing, stability, and translation. It binds to specific RNA sequences and controls their splicing, transport, and translation. QKI protein has been found to regulate the expression of numerous genes involved in cell proliferation, differentiation, and apoptosis. It also plays a role in myelination, neuronal development, and synaptic plasticity.

One of the key activities of Recombinant Human QKI Protein is its role in alternative splicing. It binds to pre-mRNA sequences and regulates the splicing of exons, leading to the production of different isoforms of a protein. This process is critical for the diversity of proteins that can be produced from a single gene.

Recombinant Human QKI Protein also plays a crucial role in RNA stability. It binds to the 3′ untranslated region (UTR) of target mRNAs and regulates their stability. This activity is essential for the proper expression of genes involved in cell growth, differentiation, and survival.

Another important activity of Recombinant Human QKI Protein is its role in translational regulation. It binds to specific sequences in the 5′ UTR of target mRNAs and controls their translation. This activity is crucial for the proper expression of genes involved in neuronal development and synaptic plasticity.

Application of Recombinant Human QKI Protein

Recombinant Human QKI Protein has a wide range of applications in both basic and clinical research. Its role in regulating RNA processing, stability, and translation makes it a valuable tool for studying gene expression and its dysregulation in various diseases.

One of the key applications of Recombinant Human QKI Protein is in the study of alternative splicing. Its ability to regulate the splicing of exons makes it a valuable tool for investigating the role of alternative splicing in various diseases, such as cancer and neurodegenerative disorders.

Recombinant Human QKI Protein is also used in the study of RNA stability. Its role in regulating the stability of target mRNAs makes it a valuable tool for investigating the mechanisms underlying RNA degradation and its dysregulation in diseases such as cancer.

In addition, Recombinant Human QKI Protein is used in the study of translational regulation. Its ability to regulate the translation of specific mRNAs makes it a valuable tool for investigating the role of translation in various cellular processes and diseases.

Furthermore, Recombinant Human QKI Protein has potential therapeutic applications. Its role in regulating gene expression and its dysregulation in diseases make it a promising target for developing therapies. For example, QKI protein has been found to be downregulated in various cancers, and its restoration has been shown to inhibit tumor growth, making it a potential target for cancer therapy.

Conclusion

Recombinant Human QKI Protein is a crucial protein involved in the regulation of RNA processing, stability, and translation. Its structure, activity, and applications make it a valuable tool for studying gene expression and its dysregulation in various diseases. As research on QKI protein continues, its potential in both basic and clinical research is

Recombinant Human QKI Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human QKI Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products