Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RAB12 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q6IQ22
Molecular weight:
21.61 kDa

Original price was: $289.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
Asp40–Lys207
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RAB12 Protein, N-His

Product name ARO-P12270-100
Uniprot ID Q6IQ22
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKK
Molecular weight 21.61 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp40-Lys207
Aliases /Synonyms RAB12, Ras-related protein Rab-12
Reference ARO-P12270
Note For research use only.
Molecular Constructor
Asp40–Lys207
Product name ARO-P12270-1MG
Uniprot ID Q6IQ22
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKK
Molecular weight 21.61 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp40-Lys207
Aliases /Synonyms RAB12, Ras-related protein Rab-12
Reference ARO-P12270
Note For research use only.
Molecular Constructor
Asp40–Lys207
Product name ARO-P12270-50
Uniprot ID Q6IQ22
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKK
Molecular weight 21.61 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp40-Lys207
Aliases /Synonyms RAB12, Ras-related protein Rab-12
Reference ARO-P12270
Note For research use only.
Molecular Constructor
Asp40–Lys207

Introduction

Recombinant Human RAB12 Protein is a highly purified, bioactive protein that plays a crucial role in various cellular processes. It is a member of the RAS superfamily of small GTPases and is involved in regulating intracellular vesicle trafficking and membrane dynamics. In this article, we will discuss the structure, activity, and applications of this important protein.

Structure of Recombinant Human RAB12 Protein

Recombinant Human RAB12 Protein is a 25-kDa protein with a conserved GTP-binding domain and a C-terminal hypervariable region. It is composed of 202 amino acids and shares high sequence homology with other members of the RAB family. The protein has a globular structure with a central β-sheet surrounded by α-helices. The GTP-binding domain, also known as the switch region, is responsible for the protein’s activity and is highly conserved among all RAB proteins.

Activity of Recombinant Human RAB12 Protein

Recombinant Human RAB12 Protein is a key regulator of intracellular vesicle trafficking and membrane dynamics. It is localized to the Golgi complex and endosomes and plays a crucial role in the transport of cargo between these compartments. The protein functions as a molecular switch, cycling between an active GTP-bound state and an inactive GDP-bound state. In its active state, RAB12 recruits effector proteins to the membrane, which mediate various cellular processes such as vesicle formation, fusion, and transport.

Applications of Recombinant Human RAB12 Protein

Recombinant Human RAB12 Protein has a wide range of applications in both basic research and biotechnology. Its role in intracellular trafficking makes it an important target for studying various diseases, including neurodegenerative disorders, cancer, and infectious diseases. Additionally, the protein has been shown to play a critical role in the formation and maintenance of the blood-brain barrier, making it a potential therapeutic target for neurological disorders.

One of the major applications of Recombinant Human RAB12 Protein is in the study of membrane trafficking. By using recombinant protein, researchers can manipulate RAB12 activity and study its effects on cellular processes such as endocytosis, exocytosis, and membrane fusion. This has led to a better understanding of the mechanisms underlying these processes and has provided insights into the role of RAB12 in various diseases.

Furthermore, Recombinant Human RAB12 Protein has been used in drug discovery and development. Its involvement in the formation of the blood-brain barrier makes it a potential target for developing drugs that can improve the delivery of therapeutics to the brain. Additionally, the protein’s role in cancer cell invasion and metastasis has made it a target for developing anti-cancer drugs.

In biotechnology, Recombinant Human RAB12 Protein has been used to produce monoclonal antibodies and recombinant vaccines. Its ability to bind to effector proteins makes it an ideal candidate for developing fusion proteins that can be used as antigens in vaccine development. Moreover, the protein’s high purity and bioactivity make it a valuable tool for protein-protein interaction studies and drug screening assays.

Conclusion

In summary, Recombinant Human RAB12 Protein is a crucial player in intracellular vesicle trafficking and membrane dynamics. Its unique structure and activity make it an important target for studying various diseases and developing therapeutics. With its wide range of applications in basic research and biotechnology, this protein continues to be a valuable tool in advancing our understanding of cellular processes and developing new treatments for diseases.

Recombinant Human RAB12 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RAB12 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products