Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RAB18 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NP72
Molecular weight:
22.89 kDa

Original price was: $278.00.Current price is: $230.00.

50ug 17% OFF + 230 loyalty points
Met1–Lys183
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RAB18 Protein, N-His

Product name ARO-P12364-100
Uniprot ID Q9NP72
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNK
Molecular weight 22.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys183
Aliases /Synonyms Ras-related protein Rab-18, RAB18
Reference ARO-P12364
Note For research use only.
Molecular Constructor
Met1–Lys183
Product name ARO-P12364-1MG
Uniprot ID Q9NP72
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNK
Molecular weight 22.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys183
Aliases /Synonyms Ras-related protein Rab-18, RAB18
Reference ARO-P12364
Note For research use only.
Molecular Constructor
Met1–Lys183
Product name ARO-P12364-50
Uniprot ID Q9NP72
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNK
Molecular weight 22.89 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys183
Aliases /Synonyms Ras-related protein Rab-18, RAB18
Reference ARO-P12364
Note For research use only.
Molecular Constructor
Met1–Lys183

Introduction to Recombinant Human RAB18 Protein

Recombinant Human RAB18 Protein, also known as Ras-related protein Rab-18, is a small GTPase protein that plays a crucial role in intracellular vesicle trafficking. It belongs to the Ras superfamily of proteins and is highly conserved across species, with a sequence similarity of 90% between human and mouse RAB18 proteins.

Structure of Recombinant Human RAB18 Protein

RAB18 protein consists of 207 amino acids and has a molecular weight of approximately 23 kDa. It has a highly conserved GTPase domain, which is essential for its function. The protein also contains a C-terminal prenylation motif, which allows it to attach to cellular membranes. This motif is important for the localization and activity of RAB18.

Activity of Recombinant Human RAB18 Protein

RAB18 protein is primarily involved in regulating intracellular vesicle trafficking, which is essential for maintaining proper cellular function. It acts as a molecular switch, cycling between an active GTP-bound state and an inactive GDP-bound state. In its active state, RAB18 interacts with various effector proteins to regulate vesicle transport and fusion.

RAB18 is mainly localized to the endoplasmic reticulum (ER) and Golgi apparatus, but it can also be found on other cellular membranes, such as the plasma membrane and endosomes. It plays a critical role in the transport of lipids and proteins between these organelles, as well as in the formation and maintenance of lipid droplets.

Application of Recombinant Human RAB18 Protein

Recombinant Human RAB18 Protein has a wide range of applications in both basic research and biotechnology. Its role in intracellular vesicle trafficking makes it a valuable tool for studying various cellular processes, including protein sorting, secretion, and organelle biogenesis.

One of the key applications of RAB18 protein is in the study of lipid metabolism. It has been shown to regulate the formation and size of lipid droplets, which are important for energy storage and membrane homeostasis. Dysregulation of RAB18 has been linked to various metabolic disorders, making it a potential target for therapeutic interventions.

In addition, RAB18 is also involved in the transport of certain pathogens, such as the hepatitis C virus, suggesting its potential role in viral infection and pathogenesis. Its involvement in membrane trafficking also makes it a potential target for drug delivery systems.

RAB18 as an Antigen

RAB18 protein has also been identified as an antigen in autoimmune diseases, such as systemic lupus erythematosus and rheumatoid arthritis. Autoantibodies against RAB18 have been detected in the serum of patients with these diseases, suggesting its potential use as a biomarker for diagnosis and monitoring disease progression.

Furthermore, RAB18 has been studied as a potential target for cancer immunotherapy. It has been shown to be overexpressed in various types of cancer, and targeting RAB18 with specific antibodies or vaccines may help to inhibit tumor growth and metastasis.

Conclusion

In summary, Recombinant Human RAB18 Protein is a highly conserved GTPase that plays a crucial role in intracellular vesicle trafficking. Its structure, activity, and applications make it a valuable tool for studying various cellular processes and diseases. Further research on RAB18 may lead to a better understanding of its

Recombinant Human RAB18 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RAB18 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products