Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RAB22A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UL26
Molecular weight:
21.49 kDa

Original price was: $284.00.Current price is: $230.00.

50ug 19% OFF + 230 loyalty points
Met1–Ala171
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RAB22A Protein, N-His

Product name ARO-P12438-100
Uniprot ID Q9UL26
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDA
Molecular weight 21.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala171
Aliases /Synonyms RAB22A, RAB22, Ras-related protein Rab-22A, Rab-22
Reference ARO-P12438
Note For research use only.
Molecular Constructor
Met1–Ala171
Product name ARO-P12438-1MG
Uniprot ID Q9UL26
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDA
Molecular weight 21.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala171
Aliases /Synonyms RAB22A, RAB22, Ras-related protein Rab-22A, Rab-22
Reference ARO-P12438
Note For research use only.
Molecular Constructor
Met1–Ala171
Product name ARO-P12438-50
Uniprot ID Q9UL26
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDA
Molecular weight 21.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala171
Aliases /Synonyms RAB22A, RAB22, Ras-related protein Rab-22A, Rab-22
Reference ARO-P12438
Note For research use only.
Molecular Constructor
Met1–Ala171

Introduction to Recombinant Human RAB22A Protein

Recombinant Human RAB22A Protein is a type of protein that is produced through genetic engineering techniques. It is a member of the RAB family of small GTPases, which are important regulators of vesicular trafficking and membrane dynamics in eukaryotic cells. This protein has been extensively studied for its structure, activity, and potential applications in various fields of research, including cell biology, immunology, and cancer research.

Structure of Recombinant Human RAB22A Protein

The recombinant form of RAB22A Protein is produced by inserting the gene encoding for the protein into a suitable expression vector, which is then introduced into a host organism, such as bacteria or yeast. The protein is then purified using various chromatography techniques to obtain a highly pure and active form. The purified protein has a molecular weight of approximately 21 kDa and consists of 191 amino acids.

The crystal structure of RAB22A Protein has been determined through X-ray crystallography, revealing a globular shape with a central core of beta sheets surrounded by alpha helices. This structure is similar to other members of the RAB family, with a conserved GTP-binding domain and a variable C-terminal region that is responsible for specific interactions with other proteins and membranes.

Activity of Recombinant Human RAB22A Protein

RAB22A Protein is a GTPase, which means it can bind and hydrolyze GTP molecules to regulate various cellular processes. In its active GTP-bound form, the protein interacts with other proteins and membranes to facilitate vesicle trafficking and fusion. This activity is essential for the proper functioning of intracellular transport pathways, including endocytosis, exocytosis, and vesicular transport between organelles.

Studies have shown that RAB22A Protein is involved in the regulation of early endosome dynamics, which is important for the sorting and recycling of various cell surface receptors and other molecules. It has also been linked to the formation of autophagosomes, which are responsible for the degradation of damaged or unnecessary cellular components. Additionally, RAB22A Protein has been implicated in the regulation of cell migration and invasion, suggesting its potential role in cancer progression.

Applications of Recombinant Human RAB22A Protein

Recombinant Human RAB22A Protein has numerous applications in various fields of research. In cell biology, it is used as a tool to study the mechanisms of vesicular trafficking and membrane dynamics. Its activity can be modulated by various factors, such as GTPase-activating proteins and guanine nucleotide exchange factors, allowing researchers to investigate the specific roles of RAB22A Protein in different cellular processes.

In immunology, RAB22A Protein has been identified as an antigen that is recognized by antibodies in patients with autoimmune diseases, such as systemic lupus erythematosus. This suggests its potential as a biomarker for disease diagnosis and as a target for therapeutic interventions.

Furthermore, RAB22A Protein has been linked to various types of cancer, including breast, lung, and pancreatic cancer. Its overexpression has been associated with tumor growth and metastasis, making it a potential target for cancer treatment.

Conclusion

Recombinant Human RAB22A Protein is a valuable tool for studying the structure, activity, and potential applications of this important member of the RAB family. Its diverse roles in cellular processes and its potential involvement in diseases make it a promising target for further research and therapeutic development.

Recombinant Human RAB22A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RAB22A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products