Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RABGEF1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UJ41
Molecular weight:
30.14 kDa

Original price was: $271.00.Current price is: $230.00.

50ug 15% OFF + 230 loyalty points
Thr131–Lys368
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RABGEF1 Protein, N-His

Product name ARO-P12042-100
Uniprot ID Q9UJ41
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TSIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEK
Molecular weight 30.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr131-Lys368
Aliases /Synonyms RAP1, Rabex-5, RABEX5, Rab5 GDP/GTP exchange factor, RABGEF1, Rabaptin-5-associated exchange factor for Rab5
Reference ARO-P12042
Note For research use only.
Molecular Constructor
Thr131–Lys368
Product name ARO-P12042-1MG
Uniprot ID Q9UJ41
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TSIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEK
Molecular weight 30.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr131-Lys368
Aliases /Synonyms RAP1, Rabex-5, RABEX5, Rab5 GDP/GTP exchange factor, RABGEF1, Rabaptin-5-associated exchange factor for Rab5
Reference ARO-P12042
Note For research use only.
Molecular Constructor
Thr131–Lys368
Product name ARO-P12042-50
Uniprot ID Q9UJ41
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence TSIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEK
Molecular weight 30.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr131-Lys368
Aliases /Synonyms RAP1, Rabex-5, RABEX5, Rab5 GDP/GTP exchange factor, RABGEF1, Rabaptin-5-associated exchange factor for Rab5
Reference ARO-P12042
Note For research use only.
Molecular Constructor
Thr131–Lys368

Introduction to Recombinant Human RABGEF1 Protein

Recombinant Human RABGEF1 Protein, also known as RABGEF1 or RABEX-5, is a protein that plays a crucial role in regulating intracellular trafficking and vesicle fusion. It is a member of the RAB guanine nucleotide exchange factor (GEF) family and is involved in the activation of small GTPases, specifically the RAB5 protein. This protein is highly conserved among different species and is essential for various cellular processes, making it a valuable tool for scientific research and potential therapeutic applications.

Structure of Recombinant Human RABGEF1 Protein

The Recombinant Human RABGEF1 Protein is a 100 kDa protein consisting of 889 amino acids. It contains a C-terminal VPS9 domain, which is responsible for its GEF activity, and an N-terminal zinc finger domain, which is involved in protein-protein interactions. The protein also has several other functional domains, including a coiled-coil domain and a RAB-binding domain, which allow it to interact with other proteins and regulate its activity.

The recombinant form of RABGEF1 is produced through genetic engineering techniques, where the gene encoding for the protein is inserted into a suitable expression system, such as bacteria or mammalian cells, to produce large quantities of the protein. This recombinant protein is then purified and can be used for various scientific applications.

Activity of Recombinant Human RABGEF1 Protein

RABGEF1 is a GEF protein, meaning it is responsible for activating small GTPases, specifically the RAB5 protein. RAB5 is a key regulator of endocytosis and intracellular trafficking, and its activation by RABGEF1 is essential for proper vesicle fusion and transport within cells.

The VPS9 domain of RABGEF1 binds to inactive RAB5 and catalyzes the exchange of GDP for GTP, which leads to the activation of RAB5. This activated form of RAB5 then recruits other proteins to the membrane, allowing for the formation of transport vesicles and subsequent fusion with target membranes. This process is vital for various cellular processes, including endocytosis, phagocytosis, and receptor recycling.

Besides its role in RAB5 activation, RABGEF1 also plays a crucial role in regulating the activity of other small GTPases, such as RAB4 and RAB22A, which are involved in different cellular processes. This further highlights the importance of RABGEF1 in maintaining proper intracellular trafficking and vesicle fusion.

Applications of Recombinant Human RABGEF1 Protein

The recombinant form of RABGEF1 has various applications in scientific research, particularly in the fields of cell biology and biochemistry. Its ability to activate RAB5 and other small GTPases makes it a valuable tool for studying intracellular trafficking and vesicle fusion processes.

Recombinant Human RABGEF1 Protein can also be used in drug discovery and development. Dysregulation of RABGEF1 has been linked to various diseases, including cancer, making it a potential therapeutic target. By studying the structure and activity of recombinant RABGEF1, researchers can gain a better understanding of its role in disease and potentially develop drugs that target this protein.

In addition, the recombinant protein can also be used for diagnostic purposes, such as in the development of assays to detect RABGEF1 levels in patient samples. This can aid in the diagnosis and monitoring of diseases where RABGEF1 is implicated.

Conclusion

Recombinant Human RABGEF1 Protein is a crucial protein involved in regulating intracellular trafficking and vesicle fusion processes.

Recombinant Human RABGEF1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RABGEF1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products