Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RASSF6 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q6ZTQ3
Molecular weight:
21.79 kDa

Original price was: $264.00.Current price is: $230.00.

50ug 13% OFF + 230 loyalty points
Met201–Glu366
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RASSF6 Protein, N-His

Product name ARO-P12401-100
Uniprot ID Q6ZTQ3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDRKERQKNRASINGHFYNHETSIFIPAFESETKVRVNSNMRTEEVIKQLLQKFKIENSPQDFALHIIFATGEQRRLKKTDIPLLQRLLQGPSEKNARIFLMDKDAEEISSDVAQYINFHFSLLESILQRLNEEEKREIQRIVTKFNKEKAIILKCLQNKLVIKTE
Molecular weight 21.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met201-Glu366
Aliases /Synonyms Ras association domain-containing protein 6, RASSF6
Reference ARO-P12401
Note For research use only.
Molecular Constructor
Met201–Glu366
Product name ARO-P12401-1MG
Uniprot ID Q6ZTQ3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDRKERQKNRASINGHFYNHETSIFIPAFESETKVRVNSNMRTEEVIKQLLQKFKIENSPQDFALHIIFATGEQRRLKKTDIPLLQRLLQGPSEKNARIFLMDKDAEEISSDVAQYINFHFSLLESILQRLNEEEKREIQRIVTKFNKEKAIILKCLQNKLVIKTE
Molecular weight 21.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met201-Glu366
Aliases /Synonyms Ras association domain-containing protein 6, RASSF6
Reference ARO-P12401
Note For research use only.
Molecular Constructor
Met201–Glu366
Product name ARO-P12401-50
Uniprot ID Q6ZTQ3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDRKERQKNRASINGHFYNHETSIFIPAFESETKVRVNSNMRTEEVIKQLLQKFKIENSPQDFALHIIFATGEQRRLKKTDIPLLQRLLQGPSEKNARIFLMDKDAEEISSDVAQYINFHFSLLESILQRLNEEEKREIQRIVTKFNKEKAIILKCLQNKLVIKTE
Molecular weight 21.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met201-Glu366
Aliases /Synonyms Ras association domain-containing protein 6, RASSF6
Reference ARO-P12401
Note For research use only.
Molecular Constructor
Met201–Glu366

Recombinant Human RASSF6 Protein, also known as Ras association domain-containing protein 6, is a protein that plays an important role in regulating cell growth and apoptosis. This protein is encoded by the RASSF6 gene and is part of the RASSF family of proteins. Recombinant Human RASSF6 Protein is produced through recombinant DNA technology and has a variety of applications in scientific research and medical treatments.

Structure of Recombinant Human RASSF6 Protein

Recombinant Human RASSF6 Protein is a 307 amino acid protein with a molecular weight of approximately 35 kDa. It contains a Ras association (RA) domain, a SARAH (Sav/Rassf/Hpo) domain, and a C-terminal coiled-coil domain. The RA domain is responsible for binding to small GTPases, while the SARAH domain is involved in protein-protein interactions. The C-terminal coiled-coil domain is important for the formation of dimers and oligomers. These structural features make Recombinant Human RASSF6 Protein a key player in signaling pathways that regulate cell growth and apoptosis.

Activity of Recombinant Human RASSF6 Protein

Recombinant Human RASSF6 Protein has been shown to interact with various proteins involved in cell signaling, including the Ras family of small GTPases, MST kinases, and the tumor suppressor protein, p53. Through these interactions, Recombinant Human RASSF6 Protein can regulate cell growth and induce apoptosis. Studies have also shown that this protein is involved in the regulation of the Hippo signaling pathway, which controls organ size and tissue regeneration. Additionally, Recombinant Human RASSF6 Protein has been found to play a role in DNA damage response and cell cycle progression.

Application of Recombinant Human RASSF6 Protein

Recombinant Human RASSF6 Protein has a wide range of applications in both scientific research and medical treatments. In research, this protein is often used as a tool to study cell signaling pathways and their role in various diseases. It can be used in biochemical assays to investigate protein-protein interactions and to screen for potential drug targets. Recombinant Human RASSF6 Protein can also be used in cell culture experiments to study its effects on cell growth and apoptosis.

In terms of medical applications, Recombinant Human RASSF6 Protein has shown potential as a therapeutic target for cancer treatment. Studies have found that this protein is downregulated in various types of cancer, and its overexpression can induce apoptosis in cancer cells. Additionally, Recombinant Human RASSF6 Protein has been found to enhance the sensitivity of cancer cells to chemotherapy drugs. This makes it a promising candidate for the development of new cancer treatments.

Furthermore, Recombinant Human RASSF6 Protein has also been investigated for its potential role in neurological disorders such as Alzheimer’s disease. Studies have shown that this protein is involved in the regulation of neuronal cell death and may play a role in the progression of Alzheimer’s disease. By understanding its function, Recombinant Human RASSF6 Protein could potentially be targeted for therapeutic interventions in this disease.

Conclusion

In summary, Recombinant Human RASSF6 Protein is a key player in regulating cell growth and apoptosis through its interactions with various signaling proteins. Its structural features and diverse functions make it a valuable tool for scientific research and a potential therapeutic target for diseases such as cancer and Alzheimer’s. Further studies on this protein will continue to provide insights into its role in cellular processes and its potential for medical applications.

Keywords: Recombinant protein, antigen, RASSF6, cell growth, apoptosis, signaling pathways, cancer, Alzheimer’s disease.

Recombinant Human RASSF6 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RASSF6 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products