Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human REC8 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95072
Molecular weight:
22.49 kDa

Original price was: $299.00.Current price is: $230.00.

50ug 23% OFF + 230 loyalty points
Leu470–His547
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human REC8 Protein, N-His-SUMO & C-Strep

Product name ARO-P12353-100
Uniprot ID O95072
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPPELELLSLEAVHRAVALELQANREPDFSSLVSPLSPRRMAARVFYLLLVLSAQQILHVKQEKPYGRLLIQPGPRFH
Molecular weight 22.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu470-His547
Aliases /Synonyms Cohesin Rec8p, Meiotic recombination protein REC8 homolog, REC8, REC8L1
Reference ARO-P12353
Note For research use only.
Molecular Constructor
Leu470–His547
Product name ARO-P12353-1MG
Uniprot ID O95072
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPPELELLSLEAVHRAVALELQANREPDFSSLVSPLSPRRMAARVFYLLLVLSAQQILHVKQEKPYGRLLIQPGPRFH
Molecular weight 22.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu470-His547
Aliases /Synonyms Cohesin Rec8p, Meiotic recombination protein REC8 homolog, REC8, REC8L1
Reference ARO-P12353
Note For research use only.
Molecular Constructor
Leu470–His547
Product name ARO-P12353-50
Uniprot ID O95072
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPPELELLSLEAVHRAVALELQANREPDFSSLVSPLSPRRMAARVFYLLLVLSAQQILHVKQEKPYGRLLIQPGPRFH
Molecular weight 22.49 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu470-His547
Aliases /Synonyms Cohesin Rec8p, Meiotic recombination protein REC8 homolog, REC8, REC8L1
Reference ARO-P12353
Note For research use only.
Molecular Constructor
Leu470–His547

Introduction to Recombinant Human REC8 Protein

Recombinant Human REC8 Protein is a highly specialized protein that plays a crucial role in the process of meiosis, which is the cell division that produces gametes (eggs and sperm) in sexually reproducing organisms. This protein is a member of the meiotic cohesin complex, which is responsible for holding together the paired chromosomes during meiosis. In this article, we will explore the structure, activity, and applications of Recombinant Human REC8 Protein.

Structure of Recombinant Human REC8 Protein

Recombinant Human REC8 Protein is a 62 kDa protein that is composed of 537 amino acids. It is encoded by the REC8 gene and is highly conserved in most eukaryotic organisms. The protein contains a central region with a coiled-coil domain, which is responsible for its ability to form complexes with other proteins. It also has an N-terminal region that is rich in basic amino acids, and a C-terminal region that is rich in acidic amino acids.

The coiled-coil domain of Recombinant Human REC8 Protein is crucial for its function in meiosis. This domain allows the protein to interact with other proteins in the meiotic cohesin complex, such as SMC1, SMC3, and STAG3. These interactions are essential for the proper assembly and function of the meiotic cohesin complex.

Activity of Recombinant Human REC8 Protein

The main function of Recombinant Human REC8 Protein is to hold together the paired chromosomes during meiosis. This is achieved through its interactions with other proteins in the meiotic cohesin complex, which form a ring-like structure around the chromosomes. This structure, known as the synaptonemal complex, is essential for the proper alignment and segregation of the chromosomes during meiosis.

In addition to its role in chromosome cohesion, Recombinant Human REC8 Protein also plays a crucial role in the regulation of recombination during meiosis. Recombination is the process by which genetic material is exchanged between homologous chromosomes, and it is essential for the production of genetically diverse gametes. Recombinant Human REC8 Protein helps to regulate this process by controlling the timing and location of recombination events.

Applications of Recombinant Human REC8 Protein

The unique properties of Recombinant Human REC8 Protein make it a valuable tool in various research applications. One of its main applications is in the study of meiosis and the role of the meiotic cohesin complex in this process. Recombinant Human REC8 Protein can be used to investigate the structure and function of the meiotic cohesin complex, as well as its interactions with other proteins.

Another important application of Recombinant Human REC8 Protein is in the development of diagnostic tests for certain genetic disorders. Mutations in the REC8 gene have been linked to several genetic disorders, including Cornelia de Lange syndrome and Roberts syndrome. By studying the structure and function of Recombinant Human REC8 Protein, researchers can gain a better understanding of these disorders and develop diagnostic tests for them.

Recombinant Human REC8 Protein also has potential therapeutic applications. As it plays a crucial role in meiosis, it is a target for the development of drugs that can disrupt or modulate its activity. These drugs could be used to treat conditions such as infertility, where proper meiotic function is essential for the production of viable gametes.

Conclusion

In summary, Recombinant Human REC8 Protein is a highly specialized protein that is essential for the proper functioning of meiosis. Its unique structure and activity make it a valuable tool in various research applications, including the study of meiosis and the development of diagnostic tests and potential therapeutics. Further studies on this protein will continue to deepen our understanding of its role in meiosis and its potential applications in the future

Recombinant Human REC8 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human REC8 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products