Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human REG3A, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q06141
Molecular weight:
15.99 kDa

Original price was: $347.00.Current price is: $274.00.

50ug 21% OFF + 274 loyalty points
Cys40–Asn164
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human REG3A, N-His

Product name ARO-P13490-100
Uniprot ID Q06141
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCN
Molecular weight 15.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys40-Asn164
Aliases /Synonyms Regenerating islet-derived protein 3-alpha, PAP1, Regenerating islet-derived protein III-alpha, Hepatointestinal pancreatic protein, REG-3-alpha, HIP, REG3A, Pancreatitis-associated protein 1, Human proislet peptide, PAP, HIP/PAP, Reg III-alpha
Reference ARO-P13490
Note For research use only.
Molecular Constructor
Cys40–Asn164
Product name ARO-P13490-1MG
Uniprot ID Q06141
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCN
Molecular weight 15.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys40-Asn164
Aliases /Synonyms Regenerating islet-derived protein 3-alpha, PAP1, Regenerating islet-derived protein III-alpha, Hepatointestinal pancreatic protein, REG-3-alpha, HIP, REG3A, Pancreatitis-associated protein 1, Human proislet peptide, PAP, HIP/PAP, Reg III-alpha
Reference ARO-P13490
Note For research use only.
Molecular Constructor
Cys40–Asn164
Product name ARO-P13490-50
Uniprot ID Q06141
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCN
Molecular weight 15.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys40-Asn164
Aliases /Synonyms Regenerating islet-derived protein 3-alpha, PAP1, Regenerating islet-derived protein III-alpha, Hepatointestinal pancreatic protein, REG-3-alpha, HIP, REG3A, Pancreatitis-associated protein 1, Human proislet peptide, PAP, HIP/PAP, Reg III-alpha
Reference ARO-P13490
Note For research use only.
Molecular Constructor
Cys40–Asn164

Recombinant Human REG3A, N-His

There are no reviews yet.

Be the first to review “Recombinant Human REG3A, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products