Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RHOT2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8IXI1
Molecular weight:
47.78 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Glu177–Phe589
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RHOT2 Protein, N-His

Product name ARO-P12405-100
Uniprot ID Q8IXI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAKQLRPACAQALTRIFRLSDQDLDQALSDEELNAFQKSCFGHPLAPQALEDVKTVVCRNVAGGVREDRLTLDGFLFLNTLFIQRGRHETTWTILRRFGYSDALELTADYLSPLIHVPPGCSTELNHLGYQFVQRVFEKHDQDRDGALSPVELQSLFSVFPAAPWGPELPRTVRTEAGRLPLHGYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSF
Molecular weight 47.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu177-Phe589
Aliases /Synonyms Ras homolog gene family member T2, MIRO-2, ARHT2, hMiro-2, Mitochondrial Rho GTPase 2, C16orf39, RHOT2
Reference ARO-P12405
Note For research use only.
Molecular Constructor
Glu177–Phe589
Product name ARO-P12405-1MG
Uniprot ID Q8IXI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAKQLRPACAQALTRIFRLSDQDLDQALSDEELNAFQKSCFGHPLAPQALEDVKTVVCRNVAGGVREDRLTLDGFLFLNTLFIQRGRHETTWTILRRFGYSDALELTADYLSPLIHVPPGCSTELNHLGYQFVQRVFEKHDQDRDGALSPVELQSLFSVFPAAPWGPELPRTVRTEAGRLPLHGYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSF
Molecular weight 47.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu177-Phe589
Aliases /Synonyms Ras homolog gene family member T2, MIRO-2, ARHT2, hMiro-2, Mitochondrial Rho GTPase 2, C16orf39, RHOT2
Reference ARO-P12405
Note For research use only.
Molecular Constructor
Glu177–Phe589
Product name ARO-P12405-50
Uniprot ID Q8IXI1
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EAKQLRPACAQALTRIFRLSDQDLDQALSDEELNAFQKSCFGHPLAPQALEDVKTVVCRNVAGGVREDRLTLDGFLFLNTLFIQRGRHETTWTILRRFGYSDALELTADYLSPLIHVPPGCSTELNHLGYQFVQRVFEKHDQDRDGALSPVELQSLFSVFPAAPWGPELPRTVRTEAGRLPLHGYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSF
Molecular weight 47.78 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu177-Phe589
Aliases /Synonyms Ras homolog gene family member T2, MIRO-2, ARHT2, hMiro-2, Mitochondrial Rho GTPase 2, C16orf39, RHOT2
Reference ARO-P12405
Note For research use only.
Molecular Constructor
Glu177–Phe589

Introduction to Recombinant Human RHOT2 Protein

Recombinant Human RHOT2 Protein, also known as Rho-related GTP-binding protein RhoT2, is a member of the Rho family of small GTPases. This protein plays a crucial role in regulating cellular processes such as cell proliferation, differentiation, and cytoskeletal organization. Recombinant Human RHOT2 Protein is produced using recombinant DNA technology, making it a valuable tool in various scientific and medical applications.

Structure of Recombinant Human RHOT2 Protein

Recombinant Human RHOT2 Protein is a 26 kDa protein that consists of 237 amino acids. It contains a conserved GTP-binding domain, a C-terminal prenylation motif, and a polybasic region. The GTP-binding domain is responsible for the protein’s ability to bind and hydrolyze GTP, while the prenylation motif allows for its proper localization to cellular membranes. The polybasic region is involved in protein-protein interactions and is crucial for the protein’s function.

Activity of Recombinant Human RHOT2 Protein

Recombinant Human RHOT2 Protein is a member of the Rho family of GTPases, which are involved in regulating various cellular processes through their ability to cycle between an active GTP-bound form and an inactive GDP-bound form. As a GTPase, Recombinant Human RHOT2 Protein plays a role in regulating actin cytoskeleton dynamics, cell migration, and cell adhesion. It also has been shown to be involved in mitochondrial dynamics and the maintenance of mitochondrial morphology.

One of the key activities of Recombinant Human RHOT2 Protein is its ability to regulate cell proliferation and differentiation. Studies have shown that overexpression of this protein can promote cell proliferation, while its depletion leads to cell cycle arrest and decreased cell proliferation. Additionally, Recombinant Human RHOT2 Protein has been implicated in the regulation of cell migration and adhesion, which are essential processes in wound healing and tissue regeneration.

Another important activity of Recombinant Human RHOT2 Protein is its role in mitochondrial dynamics. This protein has been shown to interact with other proteins involved in mitochondrial fission and fusion, suggesting its involvement in regulating mitochondrial morphology. This is supported by studies showing that depletion of Recombinant Human RHOT2 Protein leads to changes in mitochondrial shape and function.

Applications of Recombinant Human RHOT2 Protein

Recombinant Human RHOT2 Protein has a wide range of applications in both basic research and medical fields. Its ability to regulate cell proliferation, migration, and mitochondrial dynamics makes it a valuable tool in studying these cellular processes. In addition, its involvement in diseases such as cancer and neurodegenerative disorders makes it a potential therapeutic target.

One of the main applications of Recombinant Human RHOT2 Protein is in cancer research. Studies have shown that this protein is overexpressed in various types of cancer, and its depletion can inhibit cancer cell proliferation and migration. This makes it a potential target for cancer therapy, and further research is needed to fully understand its role in cancer progression.

In the field of neurodegenerative diseases, Recombinant Human RHOT2 Protein has been implicated in the pathogenesis of Parkinson’s disease. Studies have shown that this protein is involved in regulating mitochondrial dynamics, which is crucial for maintaining proper neuronal function. Dysregulation of mitochondrial dynamics has been linked to Parkinson’s disease, and Recombinant Human RHOT2 Protein may serve as a potential therapeutic target for this condition.

In conclusion, Recombinant Human RHOT2 Protein is a crucial protein involved in regulating various cellular processes. Its structure, activity, and potential applications make it a valuable tool in scientific research and a potential target for therapeutic interventions. Further studies on this protein will provide a better understanding of its role in cellular processes and its potential as a therapeutic target.

Recombinant Human RHOT2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RHOT2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products