Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RMI1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H9A7
Molecular weight:
26.02 kDa

Original price was: $303.00.Current price is: $274.00.

50ug 10% OFF + 274 loyalty points
Met1–Gly212
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RMI1 Protein, N-His

Product name ARO-P10679-100
Uniprot ID Q9H9A7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIG
Molecular weight 26.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly212
Aliases /Synonyms RecQ-mediated genome instability protein 1, RMI1, FAAP75, BLM-associated protein of 75 kDa, BLAP75, C9orf76
Reference ARO-P10679
Note For research use only.
Molecular Constructor
Met1–Gly212
Product name ARO-P10679-1MG
Uniprot ID Q9H9A7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIG
Molecular weight 26.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly212
Aliases /Synonyms RecQ-mediated genome instability protein 1, RMI1, FAAP75, BLM-associated protein of 75 kDa, BLAP75, C9orf76
Reference ARO-P10679
Note For research use only.
Molecular Constructor
Met1–Gly212
Product name ARO-P10679-50
Uniprot ID Q9H9A7
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIG
Molecular weight 26.02 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly212
Aliases /Synonyms RecQ-mediated genome instability protein 1, RMI1, FAAP75, BLM-associated protein of 75 kDa, BLAP75, C9orf76
Reference ARO-P10679
Note For research use only.
Molecular Constructor
Met1–Gly212

Introduction

Recombinant Human RMI1 Protein is a highly purified, bioactive protein that is produced through recombinant DNA technology. It is a member of the RMI1 protein family and plays a crucial role in DNA repair and maintenance. In this article, we will explore the structure, activity, and applications of Recombinant Human RMI1 Protein.

Structure of Recombinant Human RMI1 Protein

Recombinant Human RMI1 Protein is a 99 amino acid protein with a molecular weight of approximately 11.2 kDa. It contains a conserved OB-fold domain, which is responsible for its DNA binding activity. The protein also contains a C-terminal domain that interacts with other proteins involved in DNA repair processes.

Activity of Recombinant Human RMI1 Protein

Recombinant Human RMI1 Protein plays a critical role in the maintenance of genome stability by participating in homologous recombination and DNA repair pathways. It is involved in the resolution of Holliday junctions, which are DNA structures formed during homologous recombination. This protein interacts with other DNA repair proteins, such as BLM and TOP3A, to form a complex that is essential for the proper functioning of these pathways.

Furthermore, Recombinant Human RMI1 Protein has been shown to have ATPase activity, which is important for its role in DNA repair. It hydrolyzes ATP to provide energy for DNA processing and repair processes.

Applications of Recombinant Human RMI1 Protein

Recombinant Protein Production

Recombinant Human RMI1 Protein is commonly used in the production of other recombinant proteins. Its DNA binding activity and ability to form complexes with other proteins make it a valuable tool in protein purification and production processes.

Antigen in Antibody Production

Recombinant Human RMI1 Protein can also be used as an antigen to produce antibodies. Antibodies against this protein can be used in various research applications, such as Western blotting, immunofluorescence, and immunohistochemistry, to study its expression and localization in different tissues and cell types.

Cancer Research

Due to its role in DNA repair, Recombinant Human RMI1 Protein has been studied in the context of cancer research. Mutations in the genes encoding this protein have been linked to various types of cancer, such as breast and ovarian cancer. Recombinant Human RMI1 Protein can be used to study the effects of these mutations on its function and its role in cancer development.

Drug Development

Given its involvement in DNA repair and genome stability, Recombinant Human RMI1 Protein is a potential target for drug development. Inhibitors of this protein could potentially be used to sensitize cancer cells to chemotherapy or radiation therapy, making them more susceptible to DNA damage and cell death.

Diagnostic Tool

Recombinant Human RMI1 Protein can also be used as a diagnostic tool for certain genetic disorders. Mutations in the gene encoding this protein have been associated with Bloom syndrome, a rare genetic disorder characterized by a predisposition to cancer and other health problems. Testing for these mutations can aid in the diagnosis of this syndrome.

Conclusion

In summary, Recombinant Human RMI1 Protein is a crucial player in DNA repair and maintenance processes. Its structure, activity, and various applications make it a valuable tool in protein production, antibody production, cancer research, drug development, and diagnostic testing. Further research on this protein could lead

Recombinant Human RMI1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RMI1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products