Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RPS6KB2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UBS0
Molecular weight:
31.48 kDa

Original price was: $289.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
His Asp194–Pro453
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RPS6KB2 Protein, N-His

Product name ARO-P15574-100
Uniprot ID Q9UBS0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLALPPYLTPDARDLVKKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQSEEDVSQFDTRFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPP
Molecular weight 31.48 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp194-Pro453
Aliases /Synonyms p70 ribosomal S6 kinase beta, 70 kDa ribosomal protein S6 kinase 2, p70 S6 kinase beta, p70 S6KB, p70-S6K 2, S6K2, STK14B, S6K-beta, p70-beta, S6 kinase-related kinase, SRK, S6K-beta-2, Serine/threonine-protein kinase 14B, RPS6KB2, p70 S6K-beta, P70S6K2, Ribosomal protein S6 kinase beta-2
Reference ARO-P15574
Note For research use only.
Molecular Constructor
His Asp194–Pro453
Product name ARO-P15574-1MG
Uniprot ID Q9UBS0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLALPPYLTPDARDLVKKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQSEEDVSQFDTRFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPP
Molecular weight 31.48 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp194-Pro453
Aliases /Synonyms p70 ribosomal S6 kinase beta, 70 kDa ribosomal protein S6 kinase 2, p70 S6 kinase beta, p70 S6KB, p70-S6K 2, S6K2, STK14B, S6K-beta, p70-beta, S6 kinase-related kinase, SRK, S6K-beta-2, Serine/threonine-protein kinase 14B, RPS6KB2, p70 S6K-beta, P70S6K2, Ribosomal protein S6 kinase beta-2
Reference ARO-P15574
Note For research use only.
Molecular Constructor
His Asp194–Pro453
Product name ARO-P15574-50
Uniprot ID Q9UBS0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLALPPYLTPDARDLVKKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQSEEDVSQFDTRFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPP
Molecular weight 31.48 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp194-Pro453
Aliases /Synonyms p70 ribosomal S6 kinase beta, 70 kDa ribosomal protein S6 kinase 2, p70 S6 kinase beta, p70 S6KB, p70-S6K 2, S6K2, STK14B, S6K-beta, p70-beta, S6 kinase-related kinase, SRK, S6K-beta-2, Serine/threonine-protein kinase 14B, RPS6KB2, p70 S6K-beta, P70S6K2, Ribosomal protein S6 kinase beta-2
Reference ARO-P15574
Note For research use only.
Molecular Constructor
His Asp194–Pro453

There are no reviews yet.

Be the first to review “Recombinant Human RPS6KB2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products