Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RUVBL2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y230
Molecular weight:
48.31 kDa

Original price was: $259.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Gln49–Ser463
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RUVBL2 Protein, N-His

Product name ARO-P12439-100
Uniprot ID Q9Y230
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDT
Molecular weight 48.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln49-Ser463
Aliases /Synonyms 48 kDa TATA box-binding protein-interacting protein, RuvB-like 2, INO80 complex subunit J, RUVBL2, TAP54-beta, Reptin 52, TIP60-associated protein 54-beta, TIP48, TIP49B, 51 kDa erythrocyte cytosolic protein, 48 kDa TBP-interacting protein, Repressing pontin 52, INO80J, TIP49b, ECP-51
Reference ARO-P12439
Note For research use only.
Molecular Constructor
Gln49–Ser463
Product name ARO-P12439-1MG
Uniprot ID Q9Y230
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDT
Molecular weight 48.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln49-Ser463
Aliases /Synonyms 48 kDa TATA box-binding protein-interacting protein, RuvB-like 2, INO80 complex subunit J, RUVBL2, TAP54-beta, Reptin 52, TIP60-associated protein 54-beta, TIP48, TIP49B, 51 kDa erythrocyte cytosolic protein, 48 kDa TBP-interacting protein, Repressing pontin 52, INO80J, TIP49b, ECP-51
Reference ARO-P12439
Note For research use only.
Molecular Constructor
Gln49–Ser463
Product name ARO-P12439-50
Uniprot ID Q9Y230
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDT
Molecular weight 48.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln49-Ser463
Aliases /Synonyms 48 kDa TATA box-binding protein-interacting protein, RuvB-like 2, INO80 complex subunit J, RUVBL2, TAP54-beta, Reptin 52, TIP60-associated protein 54-beta, TIP48, TIP49B, 51 kDa erythrocyte cytosolic protein, 48 kDa TBP-interacting protein, Repressing pontin 52, INO80J, TIP49b, ECP-51
Reference ARO-P12439
Note For research use only.
Molecular Constructor
Gln49–Ser463

Title: Introduction to Recombinant Human RUVBL2 Protein

Recombinant Human RUVBL2 Protein, also known as RuvB-like 2, is a protein that plays a crucial role in various cellular processes. It is a member of the AAA+ ATPase family and is involved in DNA repair, transcription, and chromatin remodeling. In this article, we will explore the structure, activity, and applications of Recombinant Human RUVBL2 Protein.

Structure of Recombinant Human RUVBL2 Protein:

Recombinant Human RUVBL2 Protein is a 52 kDa protein that consists of 476 amino acids. It is composed of two domains, an N-terminal domain and a C-terminal domain, connected by a flexible linker region. The N-terminal domain contains an ATPase domain, which is responsible for the ATPase activity of RUVBL2. The C-terminal domain is involved in protein-protein interactions and plays a crucial role in the function of RUVBL2.

Activity of Recombinant Human RUVBL2 Protein:

Recombinant Human RUVBL2 Protein has ATPase activity, which is essential for its function in various cellular processes. It hydrolyzes ATP to ADP and inorganic phosphate, providing energy for its various functions. RUVBL2 is involved in DNA repair processes, where it forms a complex with other proteins to unwind and remodel damaged DNA. It is also involved in transcription, where it helps in the assembly of the RNA polymerase complex and regulates gene expression. Additionally, RUVBL2 is involved in chromatin remodeling, which is essential for regulating the accessibility of DNA to transcription factors and other proteins.

Applications of Recombinant Human RUVBL2 Protein:

Recombinant Human RUVBL2 Protein has various applications in both research and therapeutic settings. Its involvement in DNA repair and transcription makes it a crucial protein in studying these processes. Recombinant RUVBL2 Protein can be used in in vitro experiments to study its interactions with other proteins and its role in various cellular processes. It can also be used in structural studies to understand its mechanism of action.

In the field of cancer research, RUVBL2 has been identified as a potential therapeutic target. It is overexpressed in many types of cancer, and its inhibition has shown promising results in slowing down cancer cell growth. Recombinant RUVBL2 Protein can be used in drug screening assays to identify potential inhibitors of this protein.

Furthermore, Recombinant Human RUVBL2 Protein has been used in the production of monoclonal antibodies. It is used as an antigen to stimulate the immune response and produce specific antibodies against RUVBL2. These antibodies can then be used in various techniques such as Western blotting, immunofluorescence, and immunohistochemistry to study the expression and localization of RUVBL2 in different tissues and cell types.

Conclusion:

Recombinant Human RUVBL2 Protein is a crucial protein involved in various cellular processes such as DNA repair, transcription, and chromatin remodeling. Its structure, activity, and applications make it a valuable tool in both research and therapeutic settings. The use of recombinant RUVBL2 Protein in drug screening and antibody production makes it a promising target for cancer treatment. Further studies on this protein can provide valuable insights into its role in cellular processes and its potential as a therapeutic target.

Recombinant Human RUVBL2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RUVBL2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products