Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SAMM50 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y512
Molecular weight:
40.53 kDa

Original price was: $393.00.Current price is: $327.00.

100ug 17% OFF + 327 loyalty points
Leu125–Leu469
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SAMM50 Protein, N-His

Product name ARO-P11910-100
Uniprot ID Q9Y512
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LRRLTGSYNTMVGNNEGSMVLGLKLPNLLGRAEKVTFQFSYGTKETSYGLSFFKPRPGNFERNFSVNLYKVTGQFPWSSLRETDRGMSAEYSFPIWKTSHTVKWEGVWRELGCLSRTASFAVRKESGHSLKSSLSHAMVIDSRNSSILPRRGALLKVNQELAGYTGGDVSFIKEDFELQLNKQLIFDSVFSASFWGGMLVPIGDKPSSIADRFYLGGPTSIRGFSMHSIGPQSEGDYLGGEAYWAGGLHLYTPLPFRPGQGGFGELFRTHFFLNAGNLCNLNYGEGPKAHIRKLAECIRWSYGAGIVLRLGNIARLELNYCVPMGVQTGDRICDGVQFGAGIRFL
Molecular weight 40.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu125-Leu469
Aliases /Synonyms SAM50, Transformation-related gene 3 protein, Sorting and assembly machinery component 50 homolog, SAMM50, TRG-3
Reference ARO-P11910
Note For research use only.
Molecular Constructor
Leu125–Leu469
Product name ARO-P11910-1MG
Uniprot ID Q9Y512
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LRRLTGSYNTMVGNNEGSMVLGLKLPNLLGRAEKVTFQFSYGTKETSYGLSFFKPRPGNFERNFSVNLYKVTGQFPWSSLRETDRGMSAEYSFPIWKTSHTVKWEGVWRELGCLSRTASFAVRKESGHSLKSSLSHAMVIDSRNSSILPRRGALLKVNQELAGYTGGDVSFIKEDFELQLNKQLIFDSVFSASFWGGMLVPIGDKPSSIADRFYLGGPTSIRGFSMHSIGPQSEGDYLGGEAYWAGGLHLYTPLPFRPGQGGFGELFRTHFFLNAGNLCNLNYGEGPKAHIRKLAECIRWSYGAGIVLRLGNIARLELNYCVPMGVQTGDRICDGVQFGAGIRFL
Molecular weight 40.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu125-Leu469
Aliases /Synonyms SAM50, Transformation-related gene 3 protein, Sorting and assembly machinery component 50 homolog, SAMM50, TRG-3
Reference ARO-P11910
Note For research use only.
Molecular Constructor
Leu125–Leu469
Product name ARO-P11910-50
Uniprot ID Q9Y512
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LRRLTGSYNTMVGNNEGSMVLGLKLPNLLGRAEKVTFQFSYGTKETSYGLSFFKPRPGNFERNFSVNLYKVTGQFPWSSLRETDRGMSAEYSFPIWKTSHTVKWEGVWRELGCLSRTASFAVRKESGHSLKSSLSHAMVIDSRNSSILPRRGALLKVNQELAGYTGGDVSFIKEDFELQLNKQLIFDSVFSASFWGGMLVPIGDKPSSIADRFYLGGPTSIRGFSMHSIGPQSEGDYLGGEAYWAGGLHLYTPLPFRPGQGGFGELFRTHFFLNAGNLCNLNYGEGPKAHIRKLAECIRWSYGAGIVLRLGNIARLELNYCVPMGVQTGDRICDGVQFGAGIRFL
Molecular weight 40.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu125-Leu469
Aliases /Synonyms SAM50, Transformation-related gene 3 protein, Sorting and assembly machinery component 50 homolog, SAMM50, TRG-3
Reference ARO-P11910
Note For research use only.
Molecular Constructor
Leu125–Leu469

Introduction to Recombinant Human SAMM50 Protein

Recombinant Human SAMM50 Protein, also known as Sorting and Assembly Machinery 50, is a protein that plays a crucial role in the assembly and maintenance of the mitochondrial outer membrane. It is a 50-kDa protein that is encoded by the SAMM50 gene and is found in all eukaryotic cells. The recombinant form of this protein is produced through genetic engineering techniques and has numerous applications in the field of biotechnology and medicine.

Structure of Recombinant Human SAMM50 Protein

The structure of Recombinant Human SAMM50 Protein consists of 464 amino acids and has a molecular weight of 50 kDa. It is composed of three main domains: the N-terminal domain, the transmembrane domain, and the C-terminal domain. The N-terminal domain contains a conserved SAM domain, which is responsible for protein-protein interactions. The transmembrane domain spans the mitochondrial outer membrane and is essential for the protein’s function. The C-terminal domain contains a coiled-coil region that is involved in protein oligomerization.

Activity of Recombinant Human SAMM50 Protein

The primary function of Recombinant Human SAMM50 Protein is to aid in the assembly and maintenance of the mitochondrial outer membrane. It is a crucial component of the sorting and assembly machinery (SAM) complex, which is responsible for the insertion of beta-barrel proteins into the outer membrane. This protein acts as a receptor for newly synthesized beta-barrel proteins and helps in their insertion into the outer membrane.

Moreover, Recombinant Human SAMM50 Protein is also involved in the maintenance of mitochondrial morphology and organization. It interacts with other proteins in the outer membrane to regulate the fusion and fission processes of mitochondria. This protein is also known to play a role in the transport of phospholipids from the endoplasmic reticulum to the mitochondria, which is essential for the proper functioning of the organelle.

Application of Recombinant Human SAMM50 Protein

Recombinant Human SAMM50 Protein has a wide range of applications in the field of biotechnology and medicine. One of its main uses is in the production of vaccines and diagnostic kits. This protein can be used as an antigen in vaccine development to induce an immune response against mitochondrial diseases. It can also be used in diagnostic kits to detect mutations in the SAMM50 gene, which are associated with various mitochondrial disorders.

Moreover, Recombinant Human SAMM50 Protein is also used in research studies to understand the role of mitochondrial outer membrane proteins in various cellular processes. It can also be used to study the mechanisms of mitochondrial diseases and develop potential treatments for these conditions. Additionally, this protein has potential applications in the production of biofuels, as it is involved in the transport of fatty acids into the mitochondria for energy production.

Conclusion

In summary, Recombinant Human SAMM50 Protein is a crucial protein involved in the assembly and maintenance of the mitochondrial outer membrane. Its structure, activity, and applications make it a valuable tool in the fields of biotechnology and medicine. Further research on this protein can lead to a better understanding of mitochondrial diseases and the development of effective treatments.

Recombinant Human SAMM50 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SAMM50 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products