Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SNAP29 Protein, N-His-SUMO & C-Strep

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95721
Molecular weight:
23.03 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Gly34–Gly117
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SNAP29 Protein, N-His-SUMO & C-Strep

Product name ARO-P12383-100
Uniprot ID O95721
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFG
Molecular weight 23.03 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly34-Gly117
Aliases /Synonyms SNAP-29, SNAP29, Vesicle-membrane fusion protein SNAP-29, Synaptosomal-associated protein 29, Soluble 29 kDa NSF attachment protein
Reference ARO-P12383
Note For research use only.
Molecular Constructor
Gly34–Gly117
Product name ARO-P12383-1MG
Uniprot ID O95721
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFG
Molecular weight 23.03 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly34-Gly117
Aliases /Synonyms SNAP-29, SNAP29, Vesicle-membrane fusion protein SNAP-29, Synaptosomal-associated protein 29, Soluble 29 kDa NSF attachment protein
Reference ARO-P12383
Note For research use only.
Molecular Constructor
Gly34–Gly117
Product name ARO-P12383-50
Uniprot ID O95721
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFG
Molecular weight 23.03 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly34-Gly117
Aliases /Synonyms SNAP-29, SNAP29, Vesicle-membrane fusion protein SNAP-29, Synaptosomal-associated protein 29, Soluble 29 kDa NSF attachment protein
Reference ARO-P12383
Note For research use only.
Molecular Constructor
Gly34–Gly117

Introduction

Recombinant Human SNAP29 Protein, also known as synaptosomal-associated protein 29, is a key protein involved in the process of membrane fusion. This protein plays a crucial role in the formation of the SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) complex, which is responsible for the fusion of vesicles with the target membrane in various cellular processes. In this article, we will explore the structure, activity, and application of Recombinant Human SNAP29 Protein.

Structure of Recombinant Human SNAP29 Protein

Recombinant Human SNAP29 Protein is a 295 amino acid protein with a molecular weight of 33 kDa. It belongs to the SNAP family of proteins, which are characterized by the presence of a central coiled-coil domain and an N-terminal domain. The coiled-coil domain of SNAP29 is responsible for its interaction with other proteins, while the N-terminal domain is involved in the binding of SNAP29 to the SNARE complex.

The crystal structure of Recombinant Human SNAP29 Protein has been determined, revealing a four-helix bundle structure with a conserved hydrophobic core. This structure is essential for the protein’s stability and function in membrane fusion.

Activity of Recombinant Human SNAP29 Protein

Recombinant Human SNAP29 Protein is primarily known for its role in membrane fusion. It is involved in the fusion of vesicles with the target membrane in various cellular processes, such as exocytosis, endocytosis, and intracellular membrane trafficking. This process is crucial for the proper functioning of cells, as it allows for the transport of molecules and organelles within the cell and communication between cells.

SNAP29 functions by binding to the SNARE complex, which is formed by the interaction of three other proteins: syntaxin, SNAP25, and VAMP (vesicle-associated membrane protein). This interaction leads to the formation of a stable complex that brings the vesicle and the target membrane in close proximity, allowing for the fusion of the two membranes.

In addition to its role in membrane fusion, Recombinant Human SNAP29 Protein has also been shown to play a role in autophagy, a process of cellular self-degradation. It interacts with the autophagy-related protein ATG14 to regulate the formation of autophagosomes, which are responsible for the degradation of unwanted or damaged cellular components.

Application of Recombinant Human SNAP29 Protein

Recombinant Human SNAP29 Protein has a wide range of applications in both research and therapeutic fields. Its role in membrane fusion makes it a valuable tool for studying cellular processes such as exocytosis and endocytosis. It can also be used to investigate the mechanisms of diseases that are caused by defects in membrane fusion, such as neurodegenerative disorders and lysosomal storage diseases.

In the therapeutic field, Recombinant Human SNAP29 Protein has shown potential in the treatment of diseases related to autophagy dysregulation. It has been found to play a role in the formation of autophagosomes, making it a potential target for the development of drugs to treat autophagy-related diseases.

Furthermore, Recombinant Human SNAP29 Protein has been used in the development of diagnostic tools for various diseases. It has been identified as an antigen in autoimmune diseases, such as systemic lupus erythematosus and rheumatoid arthritis, and can be used in the detection of autoantibodies in patient samples.

Conclusion

In conclusion, Recombinant Human SNAP29 Protein is a crucial protein involved in the process of membrane fusion. Its structure, activity, and diverse applications make it a valuable tool for research and therapeutic purposes. Further studies on this protein can provide a better understanding of its role in cellular processes and its potential as a target for the treatment of various diseases.

Recombinant Human SNAP29 Protein, N-His-SUMO & C-Strep

There are no reviews yet.

Be the first to review “Recombinant Human SNAP29 Protein, N-His-SUMO & C-Strep”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products