Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SRPX2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O60687
Molecular weight:
47.80 kDa

Original price was: $296.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Asp66–Glu465
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SRPX2 Protein, N-His

Product name ARO-P11830-100
Uniprot ID O60687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DGEATCYSPKGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFITSGTYTCTNGVLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQGTPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE
Molecular weight 47.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp66-Glu465
Aliases /Synonyms Sushi-repeat protein upregulated in leukemia, SRPUL, Sushi repeat-containing protein SRPX2, SRPX2
Reference ARO-P11830
Note For research use only.
Molecular Constructor
Asp66–Glu465
Product name ARO-P11830-1MG
Uniprot ID O60687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DGEATCYSPKGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFITSGTYTCTNGVLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQGTPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE
Molecular weight 47.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp66-Glu465
Aliases /Synonyms Sushi-repeat protein upregulated in leukemia, SRPUL, Sushi repeat-containing protein SRPX2, SRPX2
Reference ARO-P11830
Note For research use only.
Molecular Constructor
Asp66–Glu465
Product name ARO-P11830-50
Uniprot ID O60687
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DGEATCYSPKGGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFITSGTYTCTNGVLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQGTPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLSNQELTQRREQRDICE
Molecular weight 47.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp66-Glu465
Aliases /Synonyms Sushi-repeat protein upregulated in leukemia, SRPUL, Sushi repeat-containing protein SRPX2, SRPX2
Reference ARO-P11830
Note For research use only.
Molecular Constructor
Asp66–Glu465

Title: Introduction to Recombinant Human SRPX2 Protein
Recombinant Human SRPX2 Protein: Structure and Function
The Role of Recombinant Human SRPX2 Protein in Neurodevelopmental Disorders
Applications of Recombinant Human SRPX2 Protein in Research and Medicine

Introduction:
Recombinant Human SRPX2 Protein is a type of protein that is produced in a laboratory using recombinant DNA technology. This technology allows for the production of large quantities of a specific protein, which can then be used for various research and medical purposes. In this article, we will explore the structure, function, and applications of Recombinant Human SRPX2 Protein.

Recombinant Human SRPX2 Protein: Structure and Function:
SRPX2, also known as sushi repeat-containing protein X-linked 2, is a protein that is encoded by the SRPX2 gene. It is a member of the sushi repeat-containing protein family, which is characterized by the presence of multiple sushi domains. These domains are small, conserved protein motifs that are involved in protein-protein interactions.

The structure of SRPX2 protein consists of 15 sushi repeats, which are arranged in a linear fashion. These repeats are connected by flexible linker regions, allowing for a certain degree of flexibility and mobility in the protein. The overall structure of SRPX2 protein is similar to other members of the sushi repeat-containing protein family, but it also has unique features that make it distinct.

The function of SRPX2 protein is not fully understood, but it is believed to play a role in neurodevelopment. Studies have shown that SRPX2 is highly expressed in the developing brain, particularly in areas involved in language and speech. It has also been found to interact with other proteins involved in neurodevelopment, suggesting its involvement in this process.

The Role of Recombinant Human SRPX2 Protein in Neurodevelopmental Disorders:
Given its role in neurodevelopment, it is not surprising that SRPX2 has been implicated in various neurodevelopmental disorders. Mutations in the SRPX2 gene have been linked to a condition called Rolandic epilepsy, which is characterized by seizures and speech impairment. It has also been associated with developmental language disorders, such as specific language impairment (SLI).

Recombinant Human SRPX2 Protein has been used in research to better understand the role of this protein in neurodevelopmental disorders. By producing large quantities of the protein, scientists are able to study its structure and function in more detail. This has led to a better understanding of how SRPX2 may contribute to these disorders and potential therapeutic interventions.

Applications of Recombinant Human SRPX2 Protein in Research and Medicine:
Aside from its role in neurodevelopmental disorders, Recombinant Human SRPX2 Protein has also been studied for its potential use in other areas of research and medicine. For example, it has been found to interact with proteins involved in the immune response, suggesting a potential role in immune-related disorders.

In addition, SRPX2 has been shown to have a role in cancer progression. It has been found to be overexpressed in certain types of cancer, and studies have shown that it may promote tumor growth and metastasis. Recombinant Human SRPX2 Protein has been used in research to investigate these mechanisms and explore potential therapeutic strategies for cancer treatment.

Conclusion:
In summary, Recombinant Human SRPX2 Protein is a unique protein that plays a role in neurodevelopment and has been implicated in various neurodevelopmental disorders. Its structure and function have been studied extensively, and it has been found to have potential applications in research and medicine, particularly in the fields of neurodevelopment and cancer. Further research on this protein may lead to a better understanding of its role in health and disease, and potentially new treatments for various disorders.

Recombinant Human SRPX2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SRPX2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products