Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SRSF10 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
O75494
Molecular weight:
16.70 kDa

Original price was: $262.00.Current price is: $230.00.

50ug 12% OFF + 230 loyalty points
Met1–Ser121
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SRSF10 Protein, N-His

Product name ARO-P10065-100
Uniprot ID O75494
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRS
Molecular weight 16.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser121
Aliases /Synonyms Serine/arginine-rich splicing factor 10, 40 kDa SR-repressor protein, SRrp40, FUS-interacting serine-arginine-rich protein 1, Splicing factor SRp38, Splicing factor, arginine/serine-rich 13A, TLS-associated protein with Ser-Arg repeats, TASR, TLS-associated protein with SR repeats, TLS-associated serine-arginine protein, TLS-associated SR protein, SRSF10, FUSIP1, FUSIP2, SFRS13A, TASR
Reference ARO-P10065
Note For research use only.
Molecular Constructor
Met1–Ser121
Product name ARO-P10065-1MG
Uniprot ID O75494
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRS
Molecular weight 16.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser121
Aliases /Synonyms Serine/arginine-rich splicing factor 10, 40 kDa SR-repressor protein, SRrp40, FUS-interacting serine-arginine-rich protein 1, Splicing factor SRp38, Splicing factor, arginine/serine-rich 13A, TLS-associated protein with Ser-Arg repeats, TASR, TLS-associated protein with SR repeats, TLS-associated serine-arginine protein, TLS-associated SR protein, SRSF10, FUSIP1, FUSIP2, SFRS13A, TASR
Reference ARO-P10065
Note For research use only.
Molecular Constructor
Met1–Ser121
Product name ARO-P10065-50
Uniprot ID O75494
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRS
Molecular weight 16.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ser121
Aliases /Synonyms Serine/arginine-rich splicing factor 10, 40 kDa SR-repressor protein, SRrp40, FUS-interacting serine-arginine-rich protein 1, Splicing factor SRp38, Splicing factor, arginine/serine-rich 13A, TLS-associated protein with Ser-Arg repeats, TASR, TLS-associated protein with SR repeats, TLS-associated serine-arginine protein, TLS-associated SR protein, SRSF10, FUSIP1, FUSIP2, SFRS13A, TASR
Reference ARO-P10065
Note For research use only.
Molecular Constructor
Met1–Ser121

There are no reviews yet.

Be the first to review “Recombinant Human SRSF10 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products