Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human STING1/TMEM173, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q86WV6
Molecular weight:
29.39 kDa

Original price was: $322.00.Current price is: $274.00.

50ug 15% OFF + 274 loyalty points
Leu139–Ser379
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human STING1/TMEM173, N-His

Product name ARO-P13268-100
Uniprot ID Q86WV6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS
Molecular weight 29.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu139-Ser379
Aliases /Synonyms STING1, Stimulator of interferon genes protein, Endoplasmic reticulum interferon stimulator, Transmembrane protein 173, ERIS, hSTING, TMEM173, Mediator of IRF3 activation, MITA, hMITA
Reference ARO-P13268
Note For research use only.
Molecular Constructor
Leu139–Ser379
Product name ARO-P13268-1MG
Uniprot ID Q86WV6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS
Molecular weight 29.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu139-Ser379
Aliases /Synonyms STING1, Stimulator of interferon genes protein, Endoplasmic reticulum interferon stimulator, Transmembrane protein 173, ERIS, hSTING, TMEM173, Mediator of IRF3 activation, MITA, hMITA
Reference ARO-P13268
Note For research use only.
Molecular Constructor
Leu139–Ser379
Product name ARO-P13268-50
Uniprot ID Q86WV6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS
Molecular weight 29.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu139-Ser379
Aliases /Synonyms STING1, Stimulator of interferon genes protein, Endoplasmic reticulum interferon stimulator, Transmembrane protein 173, ERIS, hSTING, TMEM173, Mediator of IRF3 activation, MITA, hMITA
Reference ARO-P13268
Note For research use only.
Molecular Constructor
Leu139–Ser379

Introduction to Recombinant Human STING1/TMEM173

Recombinant Human STING1/TMEM173, also known as Stimulator of Interferon Genes 1 (STING1) or Transmembrane Protein 173 (TMEM173), is a protein that plays a crucial role in the innate immune response. It is a member of the STING family of proteins, which are involved in detecting and responding to foreign DNA and RNA in the cytoplasm of cells. Recombinant Human STING1/TMEM173 is a highly studied protein due to its potential in various applications, including cancer therapy and vaccine development.

Structure of Recombinant Human STING1/TMEM173

Recombinant Human STING1/TMEM173 is a transmembrane protein that consists of 379 amino acids. It has a molecular weight of approximately 42 kDa and is composed of four main domains: the N-terminal domain, the central domain, the C-terminal domain, and the transmembrane domain. The N-terminal domain is responsible for binding to cyclic dinucleotides (CDNs), which are small molecules that activate the STING1 pathway. The central domain is involved in protein-protein interactions, while the C-terminal domain is important for the activation of downstream signaling pathways. The transmembrane domain anchors the protein to the endoplasmic reticulum (ER) membrane.

Activity of Recombinant Human STING1/TMEM173

Recombinant Human STING1/TMEM173 is a key mediator of the innate immune response. It is primarily expressed in immune cells, such as macrophages and dendritic cells, and is activated upon detection of cytoplasmic DNA or RNA. When CDNs bind to the N-terminal domain of STING1, it undergoes a conformational change that allows it to interact with other proteins, such as TBK1 and IRF3, leading to the production of type I interferons and pro-inflammatory cytokines. This activation of the STING1 pathway is essential for the elimination of viral and bacterial infections, as well as for the recognition and destruction of cancer cells.

Application of Recombinant Human STING1/TMEM173

Recombinant Human STING1/TMEM173 has shown great potential in various applications, particularly in the field of cancer therapy and vaccine development. As STING1 is involved in the recognition and elimination of cancer cells, it has been studied as a potential target for cancer immunotherapy. Recombinant Human STING1/TMEM173 can be used to activate the STING1 pathway in cancer cells, leading to their destruction by the immune system. This approach has shown promising results in preclinical studies and is currently being evaluated in clinical trials for various types of cancer.

In addition, Recombinant Human STING1/TMEM173 has also been explored as an adjuvant in vaccine development. Adjuvants are substances that are added to vaccines to enhance their effectiveness by stimulating the immune system. As STING1 is involved in the activation of the immune response, recombinant STING1 has been used as an adjuvant in vaccines against infectious diseases, such as influenza and hepatitis B. This approach has shown to improve the efficacy of vaccines, leading to a stronger and longer-lasting immune response.

Conclusion

In summary, Recombinant Human STING1/TMEM173 is a crucial protein in the innate immune response, responsible for detecting and responding to foreign DNA and RNA. Its structure, activity, and potential applications have made it a highly studied protein in the field of immunology. With its potential in cancer therapy and vaccine development, Recombinant Human STING1/TMEM173 holds promise for future advancements in the treatment and prevention of diseases.

Recombinant Human STING1/TMEM173, N-His

There are no reviews yet.

Be the first to review “Recombinant Human STING1/TMEM173, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products