Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SUZ12 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15022
Molecular weight:
14.77 kDa

Original price was: $262.00.Current price is: $230.00.

50ug 12% OFF + 230 loyalty points
Lys587–Gly691
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SUZ12 Protein, N-His

Product name ARO-P11405-100
Uniprot ID Q15022
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKG
Molecular weight 14.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys587-Gly691
Aliases /Synonyms SUZ12, Polycomb protein SUZ12, Joined to JAZF1 protein, CHET9, KIAA0160, ChET 9 protein, Suppressor of zeste 12 protein homolog, Chromatin precipitated E2F target 9 protein, JJAZ1
Reference ARO-P11405
Note For research use only.
Molecular Constructor
Lys587–Gly691
Product name ARO-P11405-1MG
Uniprot ID Q15022
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKG
Molecular weight 14.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys587-Gly691
Aliases /Synonyms SUZ12, Polycomb protein SUZ12, Joined to JAZF1 protein, CHET9, KIAA0160, ChET 9 protein, Suppressor of zeste 12 protein homolog, Chromatin precipitated E2F target 9 protein, JJAZ1
Reference ARO-P11405
Note For research use only.
Molecular Constructor
Lys587–Gly691
Product name ARO-P11405-50
Uniprot ID Q15022
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKG
Molecular weight 14.77 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys587-Gly691
Aliases /Synonyms SUZ12, Polycomb protein SUZ12, Joined to JAZF1 protein, CHET9, KIAA0160, ChET 9 protein, Suppressor of zeste 12 protein homolog, Chromatin precipitated E2F target 9 protein, JJAZ1
Reference ARO-P11405
Note For research use only.
Molecular Constructor
Lys587–Gly691

Introduction

Recombinant Human SUZ12 Protein is a key component of the Polycomb Repressive Complex 2 (PRC2), which plays a crucial role in epigenetic gene regulation. This protein is highly conserved across species and has been extensively studied due to its involvement in various cellular processes. In this article, we will discuss the structure, activity, and applications of Recombinant Human SUZ12 Protein.

Structure of Recombinant Human SUZ12 Protein

Recombinant Human SUZ12 Protein is a 739-amino acid protein with a molecular weight of approximately 83 kDa. It contains a conserved zinc finger domain and a C-terminal VEFS box, which are essential for its function in the PRC2 complex. The zinc finger domain is responsible for binding to the histone H3 lysine 27 (H3K27) residue, while the VEFS box interacts with other PRC2 subunits.

In addition, SUZ12 has a highly conserved SANT (SWI3, ADA2, N-CoR, and TFIIIB) domain, which is involved in protein-protein interactions and DNA binding. This domain is crucial for the recruitment of SUZ12 to specific target genes and for its enzymatic activity.

Activity of Recombinant Human SUZ12 Protein

Recombinant Human SUZ12 Protein is a core component of the PRC2 complex, which is responsible for the trimethylation of H3K27. This post-translational modification results in the formation of a repressive chromatin state, leading to the silencing of target genes. SUZ12 plays a critical role in this process by recognizing and binding to specific DNA sequences via its SANT domain and recruiting the PRC2 complex to these sites.

Moreover, SUZ12 also interacts with other PRC2 subunits, such as EZH2 and EED, to stabilize the complex and enhance its enzymatic activity. This interaction is essential for the proper functioning of PRC2 and the maintenance of gene silencing.

Applications of Recombinant Human SUZ12 Protein

Due to its crucial role in epigenetic gene regulation, Recombinant Human SUZ12 Protein has various applications in both research and medicine. Here are some of the key applications of this protein:

1. Understanding epigenetic mechanisms

Recombinant Human SUZ12 Protein has been extensively used in research to study the mechanisms of epigenetic gene regulation. By studying its structure and activity, scientists can gain insights into how this protein and the PRC2 complex function in the cell. This knowledge can help in understanding the role of epigenetics in various diseases and in developing potential treatments.

2. Biomarker for cancer diagnosis and prognosis

The PRC2 complex has been implicated in various types of cancer, and SUZ12 is often found to be overexpressed in these tumors. As a result, Recombinant Human SUZ12 Protein has been used as a biomarker for cancer diagnosis and prognosis. Its expression levels can help in identifying patients who are at a higher risk of developing cancer and in predicting the outcome of the disease.

3. Target for drug development

Given the critical role of SUZ12 in epigenetic gene regulation and its involvement in cancer, it has emerged as a potential target for drug development. Researchers are currently exploring various compounds that can inhibit the activity of SUZ12 or disrupt its interaction with other PRC2 subunits. These drugs could potentially be used to treat cancer and other diseases associated with abnormal epigenetic regulation.

4. Production of recombinant antibodies

Recombinant Human SUZ12 Protein has also been used as an antigen to produce specific antibodies for research purposes. These antibodies can be used to study the expression and localization of SUZ12 in different cell types and tissues, providing valuable insights into its function.

Conclusion

In

Recombinant Human SUZ12 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SUZ12 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products