Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PCSK5, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q92824
Molecular weight:
39.45 kDa

Original price was: $284.00.Current price is: $230.00.

50ug 19% OFF + 230 loyalty points
Asp115–Met454
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PCSK5, N-His

Product name ARO-P13206-100
Uniprot ID Q92824
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DYDFSRAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVM
Molecular weight 39.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp115-Met454
Aliases /Synonyms PC5, PC6, Proprotein convertase 6, Proprotein convertase subtilisin/kexin type 5, PCSK5, hPC6, Proprotein convertase 5, Subtilisin/kexin-like protease PC5
Reference ARO-P13206
Note For research use only.
Molecular Constructor
Asp115–Met454
Product name ARO-P13206-1MG
Uniprot ID Q92824
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DYDFSRAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVM
Molecular weight 39.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp115-Met454
Aliases /Synonyms PC5, PC6, Proprotein convertase 6, Proprotein convertase subtilisin/kexin type 5, PCSK5, hPC6, Proprotein convertase 5, Subtilisin/kexin-like protease PC5
Reference ARO-P13206
Note For research use only.
Molecular Constructor
Asp115–Met454
Product name ARO-P13206-50
Uniprot ID Q92824
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DYDFSRAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVM
Molecular weight 39.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp115-Met454
Aliases /Synonyms PC5, PC6, Proprotein convertase 6, Proprotein convertase subtilisin/kexin type 5, PCSK5, hPC6, Proprotein convertase 5, Subtilisin/kexin-like protease PC5
Reference ARO-P13206
Note For research use only.
Molecular Constructor
Asp115–Met454

Introduction

Recombinant Human PCSK5 (Proprotein Convertase Subtilisin/Kexin type 5) is a protein that plays a crucial role in the processing and activation of various proteins in the human body. It is produced through recombinant DNA technology, making it a highly pure and specific protein with a wide range of applications in both research and therapeutic fields.

Structure of Recombinant Human PCSK5

Recombinant Human PCSK5 is a 78 kDa protein that belongs to the subtilisin-like proprotein convertase family. It is composed of 715 amino acids and has a complex multidomain structure. The protein consists of a signal peptide, a prodomain, a catalytic domain, a P domain, a C-terminal domain, and a transmembrane domain.

The catalytic domain of Recombinant Human PCSK5 is responsible for its proteolytic activity and contains the highly conserved subtilisin-like catalytic triad (His-Asp-Ser). The P domain, also known as the propeptide domain, is involved in the regulation of the enzyme’s activity. The C-terminal domain is essential for the interaction of PCSK5 with its substrates.

Activity of Recombinant Human PCSK5

Recombinant Human PCSK5 is a serine protease that cleaves precursor proteins at specific sites, leading to their activation. It is involved in the processing of a variety of proteins, including growth factors, hormones, receptors, and enzymes. PCSK5 has been shown to play a crucial role in the regulation of numerous physiological processes, such as embryonic development, metabolism, and immune response.

One of the key functions of Recombinant Human PCSK5 is its role in the activation of proBDNF (brain-derived neurotrophic factor), a protein that promotes the survival and growth of neurons. PCSK5 also cleaves proNGF (nerve growth factor) into its active form, which is essential for the development and maintenance of the nervous system.

Moreover, Recombinant Human PCSK5 has been found to be involved in the processing of proinsulin, the precursor of insulin, and proglucagon, the precursor of glucagon. These hormones play a crucial role in the regulation of blood glucose levels, and PCSK5 is essential for their proper activation.

Application of Recombinant Human PCSK5

Due to its critical role in the processing and activation of various proteins, Recombinant Human PCSK5 has a wide range of applications in both research and therapeutic fields.

In research, Recombinant Human PCSK5 is used to study the role of this enzyme in different physiological processes. It is also used to investigate the processing of specific substrates and the effects of PCSK5 on their activation.

In the therapeutic field, Recombinant Human PCSK5 has shown promising results in the treatment of various diseases. For instance, PCSK5 inhibitors have been developed as potential drugs for the treatment of Alzheimer’s disease, as PCSK5 plays a role in the processing of amyloid precursor protein, a key player in the development of this disease.

Moreover, Recombinant Human PCSK5 has been studied as a potential target for the treatment of type 2 diabetes. Inhibiting PCSK5 activity has been shown to improve insulin sensitivity and glucose tolerance in animal models, making it a potential therapeutic target for this disease.

Conclusion

In conclusion, Recombinant Human PCSK5 is a crucial protein with a complex multidomain structure and a wide range of functions. Its ability to process and activate various proteins makes it an essential player in many physiological processes. Recombinant Human PCSK5 has numerous applications in research and therapeutics, and its potential as a drug target for various diseases is currently being explored. Overall, Recombinant Human PCSK5 is a valuable tool in understanding the complex processes in the human body and has the potential to contribute to the development of new treatments for various diseases.

Recombinant Human PCSK5, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PCSK5, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products