Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human OVOL1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O14753
Molecular weight:
19.94 kDa

Original price was: $252.00.Current price is: $230.00.

50ug 9% OFF + 230 loyalty points
Asp116–Leu267
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human OVOL1 Protein, N-His

Product name ARO-P11809-100
Uniprot ID O14753
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL
Molecular weight 19.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp116-Leu267
Aliases /Synonyms hOvo1, Putative transcription factor Ovo-like 1, OVOL1
Reference ARO-P11809
Note For research use only.
Molecular Constructor
Asp116–Leu267
Product name ARO-P11809-1MG
Uniprot ID O14753
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL
Molecular weight 19.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp116-Leu267
Aliases /Synonyms hOvo1, Putative transcription factor Ovo-like 1, OVOL1
Reference ARO-P11809
Note For research use only.
Molecular Constructor
Asp116–Leu267
Product name ARO-P11809-50
Uniprot ID O14753
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL
Molecular weight 19.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp116-Leu267
Aliases /Synonyms hOvo1, Putative transcription factor Ovo-like 1, OVOL1
Reference ARO-P11809
Note For research use only.
Molecular Constructor
Asp116–Leu267

Introduction

Recombinant human OVOL1 protein is a synthetic version of the human OVOL1 protein, which plays a crucial role in regulating cell differentiation and proliferation. This protein has been widely studied for its potential applications in various fields, including cancer research and tissue engineering.

Structure of Recombinant Human OVOL1 Protein

Recombinant human OVOL1 protein is a 327 amino acid protein with a molecular weight of approximately 36 kDa. It contains a conserved C2H2-type zinc finger domain, which is responsible for its DNA-binding activity. This domain allows the protein to bind to specific DNA sequences and regulate the expression of target genes.

Activity of Recombinant Human OVOL1 Protein

The main activity of recombinant human OVOL1 protein is its role in regulating cell differentiation and proliferation. It acts as a transcription factor, meaning it can bind to specific DNA sequences and control the expression of target genes. In particular, OVOL1 has been shown to regulate the expression of genes involved in cell adhesion, cell migration, and cell cycle progression.

In addition to its role in cell differentiation and proliferation, OVOL1 has also been implicated in other cellular processes such as epithelial-mesenchymal transition (EMT) and apoptosis. EMT is a process by which cells lose their epithelial characteristics and acquire a mesenchymal phenotype, which is associated with increased cell migration and invasion. OVOL1 has been shown to suppress EMT by inhibiting the expression of genes involved in this process. Similarly, OVOL1 has been found to promote apoptosis, or programmed cell death, in cancer cells.

Application of Recombinant Human OVOL1 Protein

Recombinant human OVOL1 protein has potential applications in various fields, including cancer research and tissue engineering.

Cancer Research

OVOL1 has been shown to act as a tumor suppressor in various types of cancer, including breast, colon, and lung cancer. Its ability to regulate cell differentiation and proliferation makes it a promising target for cancer therapy. Recombinant human OVOL1 protein can be used to study the mechanisms of OVOL1 in cancer and potentially develop targeted therapies for cancer treatment.

Tissue Engineering

OVOL1 has also been studied for its role in tissue engineering. Tissue engineering involves the use of cells and biomaterials to create artificial tissues or organs. OVOL1 has been found to play a critical role in the differentiation of stem cells into various cell types, making it a potential tool for tissue engineering. Recombinant human OVOL1 protein can be used to induce the differentiation of stem cells into specific cell types, such as skin cells or nerve cells, for tissue engineering applications.

Conclusion

Recombinant human OVOL1 protein is a synthetic version of the human OVOL1 protein, which plays a crucial role in regulating cell differentiation and proliferation. Its structure, activity, and potential applications make it a promising protein for various fields, including cancer research and tissue engineering. Further studies on the mechanisms of OVOL1 and its potential therapeutic applications are needed to fully understand and utilize its potential.

Recombinant Human OVOL1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human OVOL1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products