Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human DICER1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9UPY3
Molecular weight:
34.42 kDa

Original price was: $271.00.Current price is: $230.00.

50ug 15% OFF + 230 loyalty points
Leu6–Ser290
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human DICER1, N-His

Product name ARO-P13000-100
Uniprot ID Q9UPY3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHS
Molecular weight 34.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu6-Ser290
Aliases /Synonyms DICER, DICER1, Helicase MOI, Endoribonuclease Dicer, Helicase with RNase motif, HERNA, KIAA0928
Reference ARO-P13000
Note For research use only.
Molecular Constructor
Leu6–Ser290
Product name ARO-P13000-1MG
Uniprot ID Q9UPY3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHS
Molecular weight 34.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu6-Ser290
Aliases /Synonyms DICER, DICER1, Helicase MOI, Endoribonuclease Dicer, Helicase with RNase motif, HERNA, KIAA0928
Reference ARO-P13000
Note For research use only.
Molecular Constructor
Leu6–Ser290
Product name ARO-P13000-50
Uniprot ID Q9UPY3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHS
Molecular weight 34.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu6-Ser290
Aliases /Synonyms DICER, DICER1, Helicase MOI, Endoribonuclease Dicer, Helicase with RNase motif, HERNA, KIAA0928
Reference ARO-P13000
Note For research use only.
Molecular Constructor
Leu6–Ser290

Introduction to Recombinant Human DICER1

Recombinant Human DICER1 is a protein that plays a crucial role in the process of RNA interference (RNAi). This protein is produced through recombinant DNA technology, where the gene for human DICER1 is inserted into a host organism, typically a bacterial or mammalian cell, to produce large quantities of the protein. Recombinant Human DICER1 has been extensively studied and has shown promising potential in various fields, including cancer research, gene therapy, and drug development.

Structure of Recombinant Human DICER1

Recombinant Human DICER1 is a large protein with a molecular weight of approximately 220 kDa. It is composed of two RNase III domains, a PAZ domain, and a helicase domain. The RNase III domains are responsible for cleaving double-stranded RNA molecules, while the PAZ domain binds to the end of the RNA strand. The helicase domain, on the other hand, unwinds the double-stranded RNA, allowing for the cleavage by the RNase III domains. This unique structure of Recombinant Human DICER1 enables it to efficiently process RNA molecules and play a crucial role in the RNAi pathway.

Activity of Recombinant Human DICER1

The main function of Recombinant Human DICER1 is to process double-stranded RNA molecules into short interfering RNA (siRNA) molecules. This process is known as RNA interference (RNAi) and is a natural mechanism used by cells to regulate gene expression. Recombinant Human DICER1 is able to recognize and cleave the double-stranded RNA molecules at specific sites, producing siRNA molecules that are approximately 21-23 nucleotides in length. These siRNA molecules then bind to the RNA-induced silencing complex (RISC) and guide it to target mRNA molecules, leading to their degradation and silencing of gene expression.

In addition to its role in RNAi, Recombinant Human DICER1 has also been found to have other activities. It has been shown to play a role in DNA damage response, where it is involved in the repair of double-stranded DNA breaks. It has also been implicated in the regulation of gene expression at the transcriptional level, as well as in the processing of viral RNA during viral infections.

Applications of Recombinant Human DICER1

Recombinant Human DICER1 has numerous potential applications in the fields of medicine and biotechnology. One of its most promising applications is in cancer research, where it has been shown to play a role in tumor suppression. Studies have found that mutations in the DICER1 gene are associated with certain types of cancer, such as ovarian, lung, and thyroid cancer. Recombinant Human DICER1 has also been used in gene therapy, where it is used to silence specific genes that are responsible for disease development.

Another potential application of Recombinant Human DICER1 is in drug development. By understanding the structure and activity of this protein, researchers can develop drugs that target specific steps in the RNAi pathway, which could potentially lead to the development of new treatments for diseases such as cancer, viral infections, and genetic disorders.

Conclusion

In summary, Recombinant Human DICER1 is a crucial protein involved in the RNAi pathway. Its unique structure and activity make it a valuable tool in various fields, including cancer research, gene therapy, and drug development. With further research and understanding of this protein, it has the potential to revolutionize the way we treat diseases and improve human health.

Recombinant Human DICER1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human DICER1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products