Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NAP1L1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P55209
Molecular weight:
35.65 kDa

Original price was: $393.00.Current price is: $327.00.

100ug 17% OFF + 327 loyalty points
Arg72–Glu356
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NAP1L1 Protein, N-His

Product name ARO-P11844-100
Uniprot ID P55209
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDE
Molecular weight 35.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg72-Glu356
Aliases /Synonyms NAP-1-related protein, NRP, hNRP, Nucleosome assembly protein 1-like 1, NAP1L1
Reference ARO-P11844
Note For research use only.
Molecular Constructor
Arg72–Glu356
Product name ARO-P11844-1MG
Uniprot ID P55209
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDE
Molecular weight 35.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg72-Glu356
Aliases /Synonyms NAP-1-related protein, NRP, hNRP, Nucleosome assembly protein 1-like 1, NAP1L1
Reference ARO-P11844
Note For research use only.
Molecular Constructor
Arg72–Glu356
Product name ARO-P11844-50
Uniprot ID P55209
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDE
Molecular weight 35.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg72-Glu356
Aliases /Synonyms NAP-1-related protein, NRP, hNRP, Nucleosome assembly protein 1-like 1, NAP1L1
Reference ARO-P11844
Note For research use only.
Molecular Constructor
Arg72–Glu356

Introduction

The use of recombinant proteins has revolutionized the field of biotechnology and pharmaceutical research. One such protein that has gained significant attention is the Recombinant Human NAP1L1 Protein. In this article, we will discuss the structure, activity, and application of this protein in various fields.

Structure of Recombinant Human NAP1L1 Protein

The Recombinant Human NAP1L1 Protein is a member of the nucleosome assembly protein (NAP) family. It is a 52 kDa protein composed of 468 amino acids. The protein contains a highly conserved N-terminal domain and a C-terminal domain that is rich in lysine and arginine residues. The N-terminal domain is responsible for the binding of histones and DNA, while the C-terminal domain plays a crucial role in nucleosome assembly.

Activity of Recombinant Human NAP1L1 Protein

The primary function of Recombinant Human NAP1L1 Protein is to facilitate the assembly of nucleosomes, the basic unit of chromatin structure. It binds to both histones and DNA and promotes the formation of stable nucleosome complexes. This protein also plays a role in regulating gene expression by facilitating the transfer of histones to newly synthesized DNA during DNA replication.

Studies have also shown that Recombinant Human NAP1L1 Protein has a role in chromatin remodeling, which is essential for various cellular processes such as DNA repair, transcription, and replication. It has been found to interact with other chromatin-modifying enzymes and transcription factors, indicating its involvement in regulating gene expression.

Application of Recombinant Human NAP1L1 Protein

The unique structural and functional properties of Recombinant Human NAP1L1 Protein make it a versatile tool for various applications in the field of biotechnology and medicine.

Recombinant Protein Production

Recombinant Human NAP1L1 Protein can be produced in large quantities using recombinant DNA technology. This protein is widely used in research laboratories for studying its role in chromatin organization and gene expression. It is also used as a control protein in various experiments due to its high purity and stability.

Antigen for Antibody Production

Recombinant Human NAP1L1 Protein has been used as an antigen for the production of specific antibodies. These antibodies can be used for immunological assays to detect the presence of this protein in various samples. They can also be used for immunohistochemistry to visualize the distribution of this protein in tissues.

Drug Target for Cancer Therapy

Studies have shown that Recombinant Human NAP1L1 Protein is overexpressed in various types of cancer, including breast, lung, and colon cancer. This protein has been identified as a potential drug target for cancer therapy. Inhibitors of this protein have been developed and tested in preclinical studies, showing promising results in reducing tumor growth and metastasis.

Diagnostic Marker for Neurodegenerative Diseases

Recent studies have shown that Recombinant Human NAP1L1 Protein is present in higher levels in the cerebrospinal fluid of individuals with neurodegenerative diseases such as Alzheimer’s and Parkinson’s disease. This protein has been identified as a potential diagnostic marker for these diseases, and its levels can be measured to aid in early detection and treatment.

Conclusion

In summary, Recombinant Human NAP1L1 Protein is a crucial protein involved in chromatin organization and gene expression. Its unique structure and function make it a valuable tool for various applications in biotechnology and medicine. Further research on this protein may lead to new insights into its

Recombinant Human NAP1L1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NAP1L1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products