Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RBM8A Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y5S9
Molecular weight:
21.70 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Gly72–Arg152
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RBM8A Protein, N-His-SUMO

Product name ARO-P11885-100
Uniprot ID Q9Y5S9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVR
Molecular weight 21.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly72-Arg152
Aliases /Synonyms Ribonucleoprotein RBM8A, RNA-binding protein Y14, RNA-binding motif protein 8A, BOV-1, RBM8A, Binder of OVCA1-1, RBM8, RNA-binding protein 8A
Reference ARO-P11885
Note For research use only.
Molecular Constructor
Gly72–Arg152
Product name ARO-P11885-1MG
Uniprot ID Q9Y5S9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVR
Molecular weight 21.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly72-Arg152
Aliases /Synonyms Ribonucleoprotein RBM8A, RNA-binding protein Y14, RNA-binding motif protein 8A, BOV-1, RBM8A, Binder of OVCA1-1, RBM8, RNA-binding protein 8A
Reference ARO-P11885
Note For research use only.
Molecular Constructor
Gly72–Arg152
Product name ARO-P11885-50
Uniprot ID Q9Y5S9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVR
Molecular weight 21.70 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly72-Arg152
Aliases /Synonyms Ribonucleoprotein RBM8A, RNA-binding protein Y14, RNA-binding motif protein 8A, BOV-1, RBM8A, Binder of OVCA1-1, RBM8, RNA-binding protein 8A
Reference ARO-P11885
Note For research use only.
Molecular Constructor
Gly72–Arg152

Introduction

Recombinant Human RBM8A protein, also known as Y14, is a highly conserved protein that plays a crucial role in RNA metabolism and splicing. It is encoded by the RBM8A gene and is found in all eukaryotic organisms.

Structure of Recombinant Human RBM8A Protein

The RBM8A protein is composed of 130 amino acids and has a molecular weight of approximately 14.8 kDa. It contains a conserved RNA recognition motif (RRM) domain, which is responsible for its RNA binding activity. This domain is located at the N-terminus of the protein and is essential for its function in RNA splicing.

In addition to the RRM domain, the RBM8A protein also has a C-terminal domain that is involved in protein-protein interactions. This domain is required for the formation of the exon junction complex (EJC), which is a multiprotein complex involved in post-transcriptional gene regulation.

Activity of Recombinant Human RBM8A Protein

The main function of RBM8A protein is to regulate RNA splicing by binding to specific sequences in pre-mRNA molecules. It is a component of the EJC, which is deposited on mature mRNAs during splicing. The EJC plays a crucial role in mRNA localization, translation, and degradation.

RBM8A protein is also involved in nonsense-mediated mRNA decay (NMD), a process that degrades mRNAs containing premature stop codons. It is required for the recognition of these mRNAs by the NMD machinery and for their subsequent degradation.

Moreover, RBM8A protein has been shown to interact with other proteins involved in RNA metabolism, such as UPF3B and MAGOH. These interactions are essential for the proper functioning of the EJC and NMD processes.

Application of Recombinant Human RBM8A Protein

The recombinant form of RBM8A protein is widely used in various research applications. One of its main applications is in studying the role of RNA splicing and post-transcriptional gene regulation. Recombinant RBM8A protein can be used in in vitro splicing assays to investigate its binding to pre-mRNA and its role in splicing regulation.

Furthermore, recombinant RBM8A protein can be used to study the function of the EJC and NMD processes. It can be used to identify and characterize other proteins that interact with RBM8A and to understand their role in these processes.

In addition, recombinant RBM8A protein has potential therapeutic applications. Mutations in the RBM8A gene have been associated with a rare genetic disorder called Nager syndrome. Recombinant RBM8A protein can be used to study the effects of these mutations and to develop potential treatments for this disorder.

Conclusion

In summary, recombinant Human RBM8A protein is a crucial component of the EJC and plays a vital role in RNA splicing and post-transcriptional gene regulation. Its structure, activity, and application have been extensively studied, and it continues to be an essential protein in the field of RNA biology and related research areas.

Recombinant Human RBM8A Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human RBM8A Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products