Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RPS3A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P61247
Molecular weight:
26.45 kDa

Original price was: $252.00.Current price is: $230.00.

50ug 9% OFF + 230 loyalty points
Ser26–Gly233
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RPS3A Protein, N-His

Product name ARO-P11832-100
Uniprot ID P61247
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHG
Molecular weight 26.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Gly233
Aliases /Synonyms 40S ribosomal protein S3a, Fte-1, FTE1, RPS3A, v-fos transformation effector protein, Small ribosomal subunit protein eS1, MFTL
Reference ARO-P11832
Note For research use only.
Molecular Constructor
Ser26–Gly233
Product name ARO-P11832-1MG
Uniprot ID P61247
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHG
Molecular weight 26.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Gly233
Aliases /Synonyms 40S ribosomal protein S3a, Fte-1, FTE1, RPS3A, v-fos transformation effector protein, Small ribosomal subunit protein eS1, MFTL
Reference ARO-P11832
Note For research use only.
Molecular Constructor
Ser26–Gly233
Product name ARO-P11832-50
Uniprot ID P61247
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPKFELGKLMELHG
Molecular weight 26.45 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Gly233
Aliases /Synonyms 40S ribosomal protein S3a, Fte-1, FTE1, RPS3A, v-fos transformation effector protein, Small ribosomal subunit protein eS1, MFTL
Reference ARO-P11832
Note For research use only.
Molecular Constructor
Ser26–Gly233

Introduction

Recombinant proteins have become an essential tool in various fields of biomedical research, diagnostics, and therapeutics. One such protein is Recombinant Human RPS3A Protein, which has gained significant attention due to its unique structure and diverse functions. In this article, we will discuss the structure, activity, and applications of Recombinant Human RPS3A Protein.

Structure of Recombinant Human RPS3A Protein

Recombinant Human RPS3A Protein is a 30S ribosomal protein that is encoded by the RPS3A gene. It consists of 246 amino acids with a molecular weight of approximately 28 kDa. The protein has a conserved S1 domain, which is responsible for its RNA binding activity. It also has a C-terminal domain that is involved in protein-protein interactions. Recombinant Human RPS3A Protein has been extensively studied, and its crystal structure has been determined, revealing its unique three-dimensional conformation.

Activity of Recombinant Human RPS3A Protein

Recombinant Human RPS3A Protein has multiple functions, including its role as a ribosomal protein. It is a component of the 40S ribosomal subunit, which is responsible for protein synthesis. Recombinant Human RPS3A Protein also has RNA binding activity, which is crucial for its role in translation initiation. Additionally, it has been shown to have non-ribosomal functions, such as its involvement in DNA repair and transcriptional regulation.

One of the most intriguing activities of Recombinant Human RPS3A Protein is its ability to act as an antigen. It has been identified as a target antigen in several autoimmune diseases, including systemic lupus erythematosus and rheumatoid arthritis. This has sparked interest in studying the antigenic properties of Recombinant Human RPS3A Protein and its potential role in the development of autoimmune disorders.

Applications of Recombinant Human RPS3A Protein

Due to its unique structure and diverse functions, Recombinant Human RPS3A Protein has a wide range of applications. One of its most significant uses is in the production of recombinant vaccines. Recombinant Human RPS3A Protein has been identified as a potential vaccine candidate against various bacterial and viral infections. Its ability to elicit an immune response and its role as an antigen make it a promising target for vaccine development.

Recombinant Human RPS3A Protein has also been used in diagnostics, particularly in the detection of autoimmune diseases. Its antigenic properties have made it a valuable biomarker for the diagnosis and monitoring of these diseases. Additionally, Recombinant Human RPS3A Protein has been used in research studies to understand its role in various cellular processes, including ribosome biogenesis, translation, and DNA repair.

Furthermore, Recombinant Human RPS3A Protein has potential therapeutic applications. It has been shown to have anti-inflammatory properties, and its involvement in autoimmune diseases has made it a target for drug development. Recombinant Human RPS3A Protein has also been studied for its role in cancer, as it has been found to be overexpressed in various types of cancer, including breast and lung cancer. This has opened up possibilities for using Recombinant Human RPS3A Protein as a therapeutic target in cancer treatment.

Conclusion

In conclusion, Recombinant Human RPS3A Protein is a versatile protein with a unique structure and diverse functions. Its role as a ribosomal protein, RNA binding activity, and antigenic properties make it a valuable tool in various fields of research, diagnostics, and therapeutics. With ongoing studies and advancements in recombinant protein technology, the potential applications of Recombinant

Recombinant Human RPS3A Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RPS3A Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products