Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human S100A13, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q99584
Molecular weight:
13.65 kDa

Original price was: $413.00.Current price is: $327.00.

100ug 21% OFF + 327 loyalty points
Ala2–Lys98
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human S100A13, N-His

Product name ARO-P13159-100
Uniprot ID Q99584
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Molecular weight 13.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Lys98
Aliases /Synonyms Protein S100-A13, S100 calcium-binding protein A13, S100A13
Reference ARO-P13159
Note For research use only.
Molecular Constructor
Ala2–Lys98
Product name ARO-P13159-1MG
Uniprot ID Q99584
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Molecular weight 13.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Lys98
Aliases /Synonyms Protein S100-A13, S100 calcium-binding protein A13, S100A13
Reference ARO-P13159
Note For research use only.
Molecular Constructor
Ala2–Lys98
Product name ARO-P13159-50
Uniprot ID Q99584
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Molecular weight 13.65 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Lys98
Aliases /Synonyms Protein S100-A13, S100 calcium-binding protein A13, S100A13
Reference ARO-P13159
Note For research use only.
Molecular Constructor
Ala2–Lys98

Introduction

Recombinant Human S100A13 is a protein that plays a crucial role in various cellular processes. It belongs to the S100 protein family, which is a group of small calcium-binding proteins that are involved in regulating several cellular functions. S100A13 is specifically involved in the regulation of intracellular calcium levels and has been found to be associated with various diseases. In this article, we will discuss the structure, activity, and applications of Recombinant Human S100A13.

Structure of Recombinant Human S100A13

Recombinant Human S100A13 is a 10.5 kDa protein composed of 97 amino acids. It has a unique structure consisting of two EF-hand calcium-binding domains connected by a flexible linker region. The EF-hand domains are responsible for binding calcium ions, which is essential for the function of S100A13. The flexible linker region allows for conformational changes in the protein, which is crucial for its activity.

Activity of Recombinant Human S100A13

Recombinant Human S100A13 has been found to be involved in various cellular processes, including cell growth, differentiation, and apoptosis. It is primarily known for its role in regulating intracellular calcium levels. S100A13 binds to calcium ions and regulates their concentration in the cell. This is important for maintaining cellular homeostasis and for the proper functioning of various enzymes and proteins.

Apart from its role in calcium regulation, Recombinant Human S100A13 has been found to interact with other proteins, such as annexin A2 and fibronectin. These interactions are essential for the function of S100A13 in cell adhesion and migration. S100A13 has also been shown to be involved in the regulation of gene expression and protein synthesis, making it a crucial player in cellular processes.

Applications of Recombinant Human S100A13

Recombinant Human S100A13 has a wide range of applications in both research and clinical settings. Its role in regulating calcium levels makes it a valuable tool for studying cellular processes that are influenced by calcium signaling. It has been used in various studies to investigate the role of S100A13 in diseases such as cancer, Alzheimer’s, and cardiovascular diseases.

In addition, Recombinant Human S100A13 has been used as an antigen in vaccine development. Its ability to interact with other proteins and regulate gene expression makes it a potential target for therapeutic interventions. It has also been studied for its potential as a biomarker for various diseases, as its levels have been found to be altered in certain conditions.

Conclusion

In summary, Recombinant Human S100A13 is a small calcium-binding protein with a unique structure and diverse functions. It plays a crucial role in regulating calcium levels and is involved in various cellular processes. Its potential as a biomarker and therapeutic target makes it an important protein in disease research. Further studies on the structure and activity of Recombinant Human S100A13 may lead to a better understanding of its role in disease and potential for therapeutic interventions.

Recombinant Human S100A13, N-His

There are no reviews yet.

Be the first to review “Recombinant Human S100A13, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products