Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ATF6 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P18850
Molecular weight:
21.15 kDa

Original price was: $284.00.Current price is: $230.00.

50ug 19% OFF + 230 loyalty points
Ser548–Asp622
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ATF6 Protein, N-His-SUMO

Product name ARO-P11310-100
Uniprot ID P18850
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPRSYQDFFEAIRRRGDTFYVVSFRRDHLLLPATTHNKTTRPKMSIVLPAININENVINGQDYEVMMQIDCQVMD
Molecular weight 21.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser548-Asp622
Aliases /Synonyms ATF6-alpha, Cyclic AMP-dependent transcription factor ATF-6 alpha, cAMP-dependent transcription factor ATF-6 alpha, ATF6, Activating transcription factor 6 alpha
Reference ARO-P11310
Note For research use only.
Molecular Constructor
Ser548–Asp622
Product name ARO-P11310-1MG
Uniprot ID P18850
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPRSYQDFFEAIRRRGDTFYVVSFRRDHLLLPATTHNKTTRPKMSIVLPAININENVINGQDYEVMMQIDCQVMD
Molecular weight 21.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser548-Asp622
Aliases /Synonyms ATF6-alpha, Cyclic AMP-dependent transcription factor ATF-6 alpha, cAMP-dependent transcription factor ATF-6 alpha, ATF6, Activating transcription factor 6 alpha
Reference ARO-P11310
Note For research use only.
Molecular Constructor
Ser548–Asp622
Product name ARO-P11310-50
Uniprot ID P18850
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPRSYQDFFEAIRRRGDTFYVVSFRRDHLLLPATTHNKTTRPKMSIVLPAININENVINGQDYEVMMQIDCQVMD
Molecular weight 21.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser548-Asp622
Aliases /Synonyms ATF6-alpha, Cyclic AMP-dependent transcription factor ATF-6 alpha, cAMP-dependent transcription factor ATF-6 alpha, ATF6, Activating transcription factor 6 alpha
Reference ARO-P11310
Note For research use only.
Molecular Constructor
Ser548–Asp622

Introduction

Recombinant Human ATF6 Protein is a highly important and widely used protein in the field of biotechnology. It is a recombinant protein that is produced through the process of genetic engineering, making it a valuable tool for various scientific applications. In this article, we will discuss the structure, activity, and applications of Recombinant Human ATF6 Protein.

Structure of Recombinant Human ATF6 Protein

The ATF6 gene is located on chromosome 1 in humans and encodes for a protein that belongs to the basic leucine zipper (bZIP) family of transcription factors. The protein is composed of 670 amino acids and has a molecular weight of approximately 75 kDa. It is composed of three domains: an N-terminal transcriptional activation domain, a central DNA-binding domain, and a C-terminal domain that is responsible for nuclear localization and dimerization with other ATF6 proteins.

The recombinant version of the ATF6 protein is produced by cloning the gene into a suitable expression vector and then expressing it in a host cell, typically E. coli or mammalian cells. This allows for the production of large quantities of pure and functional protein for research purposes.

Activity of Recombinant Human ATF6 Protein

The main function of ATF6 protein is to regulate the unfolded protein response (UPR), a cellular stress response pathway that is activated when the endoplasmic reticulum (ER) is overwhelmed with improperly folded proteins. Under normal conditions, ATF6 is present in an inactive form in the ER membrane. When the UPR is activated, ATF6 is cleaved by proteases and translocates to the nucleus where it binds to specific DNA sequences and activates the expression of genes involved in protein folding and ER stress response.

The recombinant version of ATF6 protein retains its activity and can be used to study the UPR pathway in vitro. It can also be used to identify potential inhibitors or activators of the pathway, which can have therapeutic implications for diseases such as diabetes, neurodegenerative disorders, and cancer.

Applications of Recombinant Human ATF6 Protein

1. Research tool

Recombinant Human ATF6 Protein is a valuable tool for studying the UPR pathway and its role in various cellular processes. Its ability to bind to specific DNA sequences and regulate gene expression makes it an essential tool for understanding the molecular mechanisms of ER stress response.

2. Drug discovery

The UPR pathway has been implicated in various diseases, and targeting ATF6 protein could have therapeutic potential. Recombinant Human ATF6 Protein can be used in high-throughput screening assays to identify potential drug candidates that can modulate the UPR pathway and treat diseases such as diabetes and neurodegenerative disorders.

3. Diagnostic tool

Abnormal activation of the UPR pathway has been observed in various diseases, and measuring the levels of ATF6 protein in patient samples can serve as a diagnostic tool. Recombinant Human ATF6 Protein can be used to develop diagnostic kits for detecting the levels of ATF6 in patient samples, aiding in the early detection and management of diseases.

Conclusion

In summary, Recombinant Human ATF6 Protein is a crucial protein in biotechnology, with a well-defined structure, important activity, and diverse applications. Its role in regulating the UPR pathway makes it a valuable tool for research, drug discovery, and diagnostics. With ongoing research and advancements in genetic engineering techniques, the potential applications of this protein are continuously expanding, making it an essential component in the field of biotechnology.

Recombinant Human ATF6 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human ATF6 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products