Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TMPRSS4, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NRS4
Molecular weight:
44.68 kDa

Original price was: $318.00.Current price is: $274.00.

50ug 14% OFF + 274 loyalty points
Lys54–Leu437
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TMPRSS4, N-His

Product name ARO-P13062-100
Uniprot ID Q9NRS4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KVILDKYYFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKAEL
Molecular weight 44.68 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys54-Leu437
Aliases /Synonyms CAPH2, Transmembrane protease serine 4, TMPRSS3, TMPRSS4, Channel-activating protease 2, Membrane-type serine protease 2, MT-SP2
Reference ARO-P13062
Note For research use only.
Molecular Constructor
Lys54–Leu437
Product name ARO-P13062-1MG
Uniprot ID Q9NRS4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KVILDKYYFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKAEL
Molecular weight 44.68 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys54-Leu437
Aliases /Synonyms CAPH2, Transmembrane protease serine 4, TMPRSS3, TMPRSS4, Channel-activating protease 2, Membrane-type serine protease 2, MT-SP2
Reference ARO-P13062
Note For research use only.
Molecular Constructor
Lys54–Leu437
Product name ARO-P13062-50
Uniprot ID Q9NRS4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KVILDKYYFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNVWKAEL
Molecular weight 44.68 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys54-Leu437
Aliases /Synonyms CAPH2, Transmembrane protease serine 4, TMPRSS3, TMPRSS4, Channel-activating protease 2, Membrane-type serine protease 2, MT-SP2
Reference ARO-P13062
Note For research use only.
Molecular Constructor
Lys54–Leu437

Introduction

Recombinant Human TMPRSS4 is a protein that plays a crucial role in various biological processes, including cell signaling, proliferation, and differentiation. It is a member of the type II transmembrane serine protease family and is encoded by the TMPRSS4 gene. This protein has been extensively studied due to its potential therapeutic applications in cancer and other diseases.

Structure of Recombinant Human TMPRSS4

Recombinant Human TMPRSS4 is a 492 amino acid protein with a molecular weight of approximately 54 kDa. It is composed of a signal peptide, a propeptide, a catalytic domain, a transmembrane region, and a cytoplasmic tail. The catalytic domain contains the serine protease motif, which is essential for its enzymatic activity.

Activity of Recombinant Human TMPRSS4

Recombinant Human TMPRSS4 is a serine protease that plays a crucial role in the activation of various proteins, including growth factors, cytokines, and receptors. It is also involved in the processing of extracellular matrix proteins, which is essential for cell migration and invasion. This protein has been shown to cleave the extracellular domain of various cell surface proteins, such as E-cadherin, which is crucial for cell-cell adhesion and tumor suppression.

Moreover, Recombinant Human TMPRSS4 has been found to be overexpressed in various cancers, including breast, lung, and pancreatic cancer. Its overexpression has been associated with tumor growth, invasion, and metastasis. This is due to its ability to activate pro-metastatic factors, such as hepatocyte growth factor (HGF) and urokinase-type plasminogen activator (uPA), and to promote epithelial-mesenchymal transition (EMT).

Application of Recombinant Human TMPRSS4

Recombinant Human TMPRSS4 has been widely used as a research tool to study its role in various biological processes and diseases. Its enzymatic activity has been utilized to investigate its role in the activation of growth factors and receptors, as well as its involvement in cell migration and invasion. Furthermore, its overexpression in cancer has made it a potential therapeutic target for the treatment of various cancers.

One of the potential applications of Recombinant Human TMPRSS4 is in cancer therapy. Its overexpression in cancer cells makes it a promising target for the development of novel anti-cancer drugs. Inhibition of TMPRSS4 activity has been shown to reduce tumor growth and metastasis in preclinical studies, making it a potential target for the treatment of aggressive and metastatic cancers.

In addition, Recombinant Human TMPRSS4 has also been investigated for its potential role in inflammatory diseases. Its involvement in the processing of pro-inflammatory cytokines, such as interleukin-1β (IL-1β), has made it a potential target for the treatment of inflammatory diseases, such as rheumatoid arthritis and inflammatory bowel disease.

Conclusion

Recombinant Human TMPRSS4 is a serine protease that plays a crucial role in various biological processes, including cell signaling, proliferation, and differentiation. Its overexpression in cancer has made it a potential therapeutic target for the treatment of various cancers. In addition, its involvement in inflammatory diseases has also made it a potential target for the treatment of these conditions. Further research and development of inhibitors targeting TMPRSS4 could lead to the development of novel and effective treatments for cancer and inflammatory diseases.

Recombinant Human TMPRSS4, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TMPRSS4, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products