Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TNP1 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P09430
Molecular weight:
34.46 kDa

Original price was: $252.00.Current price is: $230.00.

50ug 9% OFF + 230 loyalty points
GST Met1–Leu55 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TNP1 Protein, N-GST & C-His

Product name ARO-P16098-100
Uniprot ID P09430
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL
Molecular weight 34.46 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu55
Aliases /Synonyms Spermatid nuclear transition protein 1, STP-1, TP-1, TNP1
Reference ARO-P16098
Note For research use only.
Molecular Constructor
GST Met1–Leu55 His
Product name ARO-P16098-1MG
Uniprot ID P09430
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL
Molecular weight 34.46 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu55
Aliases /Synonyms Spermatid nuclear transition protein 1, STP-1, TP-1, TNP1
Reference ARO-P16098
Note For research use only.
Molecular Constructor
GST Met1–Leu55 His
Product name ARO-P16098-50
Uniprot ID P09430
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL
Molecular weight 34.46 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu55
Aliases /Synonyms Spermatid nuclear transition protein 1, STP-1, TP-1, TNP1
Reference ARO-P16098
Note For research use only.
Molecular Constructor
GST Met1–Leu55 His

There are no reviews yet.

Be the first to review “Recombinant Human TNP1 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products