Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TRIM16 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O95361
Molecular weight:
23.26 kDa

Original price was: $406.00.Current price is: $327.00.

100ug 19% OFF + 327 loyalty points
Lys384–Pro564
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TRIM16 Protein, N-His

Product name ARO-P12085-100
Uniprot ID O95361
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KYLRLQEENRKVTNTTPWEHPYPDLPSRFLHWRQVLSQQSLYLHRYYFEVEIFGAGTYVGLTCKGIDRKGEERNSCISGNNFSWSLQWNGKEFTAWYSDMETPLKAGPFRRLGVYIDFPGGILSFYGVEYDTMTLVHKFACKFSEPVYAAFWLSKKENAIRIVDLGEEPEKPAPSLVGTAP
Molecular weight 23.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys384-Pro564
Aliases /Synonyms Estrogen-responsive B box protein, Tripartite motif-containing protein 16, TRIM16, EBBP, E3 ubiquitin-protein ligase TRIM16
Reference ARO-P12085
Note For research use only.
Molecular Constructor
Lys384–Pro564
Product name ARO-P12085-1MG
Uniprot ID O95361
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KYLRLQEENRKVTNTTPWEHPYPDLPSRFLHWRQVLSQQSLYLHRYYFEVEIFGAGTYVGLTCKGIDRKGEERNSCISGNNFSWSLQWNGKEFTAWYSDMETPLKAGPFRRLGVYIDFPGGILSFYGVEYDTMTLVHKFACKFSEPVYAAFWLSKKENAIRIVDLGEEPEKPAPSLVGTAP
Molecular weight 23.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys384-Pro564
Aliases /Synonyms Estrogen-responsive B box protein, Tripartite motif-containing protein 16, TRIM16, EBBP, E3 ubiquitin-protein ligase TRIM16
Reference ARO-P12085
Note For research use only.
Molecular Constructor
Lys384–Pro564
Product name ARO-P12085-50
Uniprot ID O95361
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence KYLRLQEENRKVTNTTPWEHPYPDLPSRFLHWRQVLSQQSLYLHRYYFEVEIFGAGTYVGLTCKGIDRKGEERNSCISGNNFSWSLQWNGKEFTAWYSDMETPLKAGPFRRLGVYIDFPGGILSFYGVEYDTMTLVHKFACKFSEPVYAAFWLSKKENAIRIVDLGEEPEKPAPSLVGTAP
Molecular weight 23.26 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys384-Pro564
Aliases /Synonyms Estrogen-responsive B box protein, Tripartite motif-containing protein 16, TRIM16, EBBP, E3 ubiquitin-protein ligase TRIM16
Reference ARO-P12085
Note For research use only.
Molecular Constructor
Lys384–Pro564

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, where specific DNA sequences are inserted into host cells to express a desired protein. These proteins have various applications in the fields of biotechnology, medicine, and research. One such recombinant protein is the Human TRIM16 protein, which has gained significant attention in recent years due to its unique structure and diverse functions.

Structure of Recombinant Human TRIM16 Protein

The TRIM16 protein, also known as tripartite motif-containing 16, is a member of the tripartite motif (TRIM) family of proteins. It is a 55 kDa protein that consists of a tripartite motif domain, a B-box domain, and a coiled-coil domain. The tripartite motif domain is responsible for the E3 ubiquitin ligase activity of TRIM16, while the B-box and coiled-coil domains are involved in protein-protein interactions.

The recombinant human TRIM16 protein is produced through the expression of its gene in host cells, such as E. coli or mammalian cells. The resulting protein is then purified using various techniques, such as chromatography, to obtain a highly pure and active form of TRIM16.

Activity of Recombinant Human TRIM16 Protein

The main function of TRIM16 is its E3 ubiquitin ligase activity, which is responsible for the attachment of ubiquitin molecules to target proteins. This process, known as ubiquitination, plays a crucial role in protein degradation, cell signaling, and immune response. TRIM16 has been shown to target various proteins, including transcription factors, viral proteins, and tumor suppressors, for ubiquitination and subsequent degradation.

In addition to its E3 ubiquitin ligase activity, TRIM16 also has other functions, such as regulation of cell cycle progression, modulation of immune response, and inhibition of viral replication. These activities are mediated through its interactions with various proteins and signaling pathways.

Application of Recombinant Human TRIM16 Protein

The unique structure and diverse functions of TRIM16 make it a promising candidate for various applications in biotechnology and medicine. One of the potential applications of recombinant TRIM16 is in cancer therapy. As TRIM16 has been shown to target and degrade tumor suppressor proteins, it could be used to inhibit the growth and spread of cancer cells. Additionally, TRIM16 has also been reported to have anti-viral properties, making it a potential candidate for the development of antiviral drugs.

Moreover, the E3 ubiquitin ligase activity of TRIM16 can be utilized in protein engineering and drug discovery. By targeting specific proteins for ubiquitination and degradation, recombinant TRIM16 can be used to study the function of these proteins and identify potential drug targets.

Furthermore, the ability of TRIM16 to modulate immune response and cell cycle progression makes it a valuable tool in immunotherapy and cell-based therapies. Recombinant TRIM16 can be used to regulate immune cell function and proliferation, which can be beneficial in treating various immune disorders and diseases.

Conclusion

In summary, the recombinant human TRIM16 protein is a unique and versatile protein with a tripartite motif domain, B-box domain, and coiled-coil domain. Its E3 ubiquitin ligase activity and other functions make it a promising candidate for various applications in biotechnology and medicine. As research on TRIM16 continues, it is expected to uncover more potential applications and contribute to further advancements in the field of protein science.

Recombinant Human TRIM16 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TRIM16 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products