Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TRIM9 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9C026
Molecular weight:
21.25 kDa

Original price was: $296.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Asp541–Ala710
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TRIM9 Protein, N-His

Product name ARO-P11682-100
Uniprot ID Q9C026
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSKGIHYWELTVDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKNLTFFINDEQQGPIAFDNVEGLFFPAVSLNRNVQVTLHTGLPVPDFYSSRASIA
Molecular weight 21.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp541-Ala710
Aliases /Synonyms Tripartite motif-containing protein 9, RING-type E3 ubiquitin transferase TRIM9, RNF91, RING finger protein 91, TRIM9, KIAA0282, E3 ubiquitin-protein ligase TRIM9
Reference ARO-P11682
Note For research use only.
Molecular Constructor
Asp541–Ala710
Product name ARO-P11682-1MG
Uniprot ID Q9C026
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSKGIHYWELTVDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKNLTFFINDEQQGPIAFDNVEGLFFPAVSLNRNVQVTLHTGLPVPDFYSSRASIA
Molecular weight 21.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp541-Ala710
Aliases /Synonyms Tripartite motif-containing protein 9, RING-type E3 ubiquitin transferase TRIM9, RNF91, RING finger protein 91, TRIM9, KIAA0282, E3 ubiquitin-protein ligase TRIM9
Reference ARO-P11682
Note For research use only.
Molecular Constructor
Asp541–Ala710
Product name ARO-P11682-50
Uniprot ID Q9C026
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSKGIHYWELTVDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKNLTFFINDEQQGPIAFDNVEGLFFPAVSLNRNVQVTLHTGLPVPDFYSSRASIA
Molecular weight 21.25 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp541-Ala710
Aliases /Synonyms Tripartite motif-containing protein 9, RING-type E3 ubiquitin transferase TRIM9, RNF91, RING finger protein 91, TRIM9, KIAA0282, E3 ubiquitin-protein ligase TRIM9
Reference ARO-P11682
Note For research use only.
Molecular Constructor
Asp541–Ala710

Title: Understanding the Structure and Function of Recombinant Human TRIM9 Protein

Introduction:
Recombinant proteins have revolutionized the field of biotechnology and have become essential tools in various research and clinical applications. One such protein is the Recombinant Human TRIM9 Protein, which has gained significant interest in recent years due to its diverse functions and potential therapeutic applications. In this article, we will delve into the structure, activity, and applications of this protein in detail.

Structure of Recombinant Human TRIM9 Protein:
TRIM9 (Tripartite motif-containing protein 9) is a member of the TRIM family of proteins, which are characterized by the presence of a tripartite motif consisting of a RING domain, B-box domain, and coiled-coil domain. The human TRIM9 gene is located on chromosome 11 and encodes for a protein of 1,332 amino acids. The recombinant form of TRIM9 protein is produced by expressing the gene in a suitable expression system, such as bacteria, yeast, or mammalian cells.

The recombinant TRIM9 protein consists of several functional domains, including a RING domain at the N-terminus, two B-box domains, and a coiled-coil domain at the C-terminus. These domains play a crucial role in the protein’s function by mediating protein-protein interactions, ubiquitin ligase activity, and intracellular localization.

Activity of Recombinant Human TRIM9 Protein:
TRIM9 is a multifunctional protein that has been implicated in various cellular processes, including cell proliferation, differentiation, and survival. It is also involved in the regulation of immune responses and neuronal development. The RING domain of TRIM9 confers E3 ubiquitin ligase activity, which allows the protein to bind to target proteins and facilitate their degradation via the proteasome pathway.

One of the key functions of TRIM9 is its role in regulating the activity of the Wnt signaling pathway, which plays a crucial role in embryonic development and tissue homeostasis. TRIM9 has been shown to interact with key components of the Wnt pathway, such as β-catenin and Axin, and modulate their stability and activity. This highlights the importance of TRIM9 in regulating critical cellular processes.

Applications of Recombinant Human TRIM9 Protein:
The diverse functions of TRIM9 make it an attractive target for various research and therapeutic applications. One of the major areas of interest is in the field of cancer research, where TRIM9 has been shown to play a role in tumor growth and metastasis. Studies have demonstrated that TRIM9 expression is upregulated in several types of cancer, and targeting TRIM9 could potentially inhibit tumor growth and metastasis.

Another potential application of recombinant TRIM9 protein is in the development of therapeutics for neurodegenerative diseases. TRIM9 has been shown to play a role in neuronal development and survival, and its dysregulation has been linked to neurodegenerative disorders such as Alzheimer’s disease and Parkinson’s disease. Targeting TRIM9 could potentially provide a novel approach for treating these debilitating diseases.

Conclusion:
In conclusion, recombinant human TRIM9 protein is a multifunctional protein with diverse roles in cellular processes. Its unique structure and activity make it a valuable tool for research and potential therapeutic applications. Further studies on the protein’s functions and interactions could provide valuable insights into its role in various diseases and pave the way for the development of novel treatments.

Recombinant Human TRIM9 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TRIM9 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products