Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TROAP Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q12815
Molecular weight:
19.56 kDa

Original price was: $367.00.Current price is: $327.00.

100ug 11% OFF + 327 loyalty points
Leu386–Val450
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TROAP Protein, N-His-SUMO

Product name ARO-P11680-100
Uniprot ID Q12815
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPWEQVAVRLFDQESCIRSLEGSGKPPVATPSGPHSNRTPSLQEVKIQRIGILQQLLRQEVEGLV
Molecular weight 19.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu386-Val450
Aliases /Synonyms Trophinin-assisting protein, TROAP, Trophinin-associated protein, Tastin
Reference ARO-P11680
Note For research use only.
Molecular Constructor
Leu386–Val450
Product name ARO-P11680-1MG
Uniprot ID Q12815
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPWEQVAVRLFDQESCIRSLEGSGKPPVATPSGPHSNRTPSLQEVKIQRIGILQQLLRQEVEGLV
Molecular weight 19.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu386-Val450
Aliases /Synonyms Trophinin-assisting protein, TROAP, Trophinin-associated protein, Tastin
Reference ARO-P11680
Note For research use only.
Molecular Constructor
Leu386–Val450
Product name ARO-P11680-50
Uniprot ID Q12815
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LPWEQVAVRLFDQESCIRSLEGSGKPPVATPSGPHSNRTPSLQEVKIQRIGILQQLLRQEVEGLV
Molecular weight 19.56 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu386-Val450
Aliases /Synonyms Trophinin-assisting protein, TROAP, Trophinin-associated protein, Tastin
Reference ARO-P11680
Note For research use only.
Molecular Constructor
Leu386–Val450

Introduction

Recombinant human TROAP protein, also known as trophinin-associated protein, is a type I transmembrane protein that is encoded by the TROAP gene. It is a member of the trophinin family of proteins, which play important roles in cell adhesion and signaling. Recombinant human TROAP protein is produced through genetic engineering techniques and has been extensively studied for its structure, activity, and potential applications.

Structure of Recombinant Human TROAP Protein

The recombinant human TROAP protein is composed of 535 amino acids, with a predicted molecular weight of 58 kDa. It consists of a cytoplasmic domain, a transmembrane domain, and an extracellular domain. The extracellular domain contains a conserved domain known as the trophinin domain, which is essential for protein-protein interactions and cell adhesion. The cytoplasmic domain contains a PDZ-binding motif, which allows for interactions with other proteins involved in cell signaling.

Activity of Recombinant Human TROAP Protein

Recombinant human TROAP protein has been shown to play a role in cell adhesion, cell migration, and cell signaling. It has been found to interact with other trophinin family proteins, such as trophinin and tastin, to form a complex that is involved in cell adhesion and embryo implantation. Studies have also shown that TROAP is expressed in various tissues, including the placenta, kidney, and brain, suggesting a potential role in tissue development and maintenance.

In addition to its role in cell adhesion, recombinant human TROAP protein has also been found to play a role in cell signaling. It has been shown to interact with the protein tyrosine phosphatase PTPN13, which is involved in regulating cell growth and proliferation. This interaction may play a role in controlling cell signaling pathways and could have implications in diseases such as cancer.

Applications of Recombinant Human TROAP Protein

Recombinant human TROAP protein has potential applications in both research and medicine. Its role in cell adhesion and signaling makes it a valuable tool for studying cell behavior and interactions. It can be used in cell culture experiments to investigate the effects of TROAP on cell adhesion and migration. Additionally, recombinant human TROAP protein can be used to study the interactions between TROAP and other proteins, such as PTPN13, in cell signaling pathways.

In medicine, recombinant human TROAP protein has been investigated as a potential biomarker for certain types of cancer. Studies have shown that TROAP is overexpressed in various types of cancer, including breast, lung, and ovarian cancer. This overexpression has been linked to increased cell proliferation and metastasis, making TROAP a potential target for cancer therapy.

Furthermore, recombinant human TROAP protein has been explored as a potential therapeutic target for infertility. As TROAP is involved in embryo implantation, it has been suggested that targeting this protein could improve the success rates of in vitro fertilization procedures.

Conclusion

Recombinant human TROAP protein is a versatile and important protein that plays a role in cell adhesion, migration, and signaling. Its structure and activity have been extensively studied, and it has potential applications in both research and medicine. Further research on this protein could lead to a better understanding of its functions and potential therapeutic uses.

Recombinant Human TROAP Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human TROAP Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products