Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TSPYL2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H2G4
Molecular weight:
21.28 kDa

Original price was: $271.00.Current price is: $230.00.

50ug 15% OFF + 230 loyalty points
His Pro263–Arg418
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TSPYL2 Protein, N-His

Product name ARO-P16247-100
Uniprot ID Q9H2G4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PGFWVKAFLNHPRISILINRRDEDIFRYLTNLQVQDLRHISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEPQARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGR
Molecular weight 21.28 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro263-Arg418
Aliases /Synonyms NP79, Nuclear protein of 79 kDa, CTCL-associated antigen se20-4, Cutaneous T-cell lymphoma-associated antigen se20-4, TSPY-like protein 2, DENTT, Differentially-expressed nucleolar TGF-beta1 target protein, Testis-specific Y-encoded-like protein 2, CDA1, Cell division autoantigen 1, TSPX, TSPYL2
Reference ARO-P16247
Note For research use only.
Molecular Constructor
His Pro263–Arg418
Product name ARO-P16247-1MG
Uniprot ID Q9H2G4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PGFWVKAFLNHPRISILINRRDEDIFRYLTNLQVQDLRHISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEPQARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGR
Molecular weight 21.28 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro263-Arg418
Aliases /Synonyms NP79, Nuclear protein of 79 kDa, CTCL-associated antigen se20-4, Cutaneous T-cell lymphoma-associated antigen se20-4, TSPY-like protein 2, DENTT, Differentially-expressed nucleolar TGF-beta1 target protein, Testis-specific Y-encoded-like protein 2, CDA1, Cell division autoantigen 1, TSPX, TSPYL2
Reference ARO-P16247
Note For research use only.
Molecular Constructor
His Pro263–Arg418
Product name ARO-P16247-50
Uniprot ID Q9H2G4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PGFWVKAFLNHPRISILINRRDEDIFRYLTNLQVQDLRHISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEPQARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGR
Molecular weight 21.28 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro263-Arg418
Aliases /Synonyms NP79, Nuclear protein of 79 kDa, CTCL-associated antigen se20-4, Cutaneous T-cell lymphoma-associated antigen se20-4, TSPY-like protein 2, DENTT, Differentially-expressed nucleolar TGF-beta1 target protein, Testis-specific Y-encoded-like protein 2, CDA1, Cell division autoantigen 1, TSPX, TSPYL2
Reference ARO-P16247
Note For research use only.
Molecular Constructor
His Pro263–Arg418

There are no reviews yet.

Be the first to review “Recombinant Human TSPYL2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products