Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TUBGCP3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96CW5
Molecular weight:
37.87 kDa

Original price was: $282.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Ile245–Ser554
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TUBGCP3 Protein, N-His

Product name ARO-P12260-100
Uniprot ID Q96CW5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRKVLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYS
Molecular weight 37.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile245-Ser554
Aliases /Synonyms Gamma-ring complex protein 104 kDa, GCP-3, hGrip104, Spindle pole body protein Spc98 homolog, GCP3, h104p, Gamma-tubulin complex component 3, hGCP3, TUBGCP3, hSpc98
Reference ARO-P12260
Note For research use only.
Molecular Constructor
Ile245–Ser554
Product name ARO-P12260-1MG
Uniprot ID Q96CW5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRKVLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYS
Molecular weight 37.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile245-Ser554
Aliases /Synonyms Gamma-ring complex protein 104 kDa, GCP-3, hGrip104, Spindle pole body protein Spc98 homolog, GCP3, h104p, Gamma-tubulin complex component 3, hGCP3, TUBGCP3, hSpc98
Reference ARO-P12260
Note For research use only.
Molecular Constructor
Ile245–Ser554
Product name ARO-P12260-50
Uniprot ID Q96CW5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence ITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWLHNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRKVLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYS
Molecular weight 37.87 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ile245-Ser554
Aliases /Synonyms Gamma-ring complex protein 104 kDa, GCP-3, hGrip104, Spindle pole body protein Spc98 homolog, GCP3, h104p, Gamma-tubulin complex component 3, hGCP3, TUBGCP3, hSpc98
Reference ARO-P12260
Note For research use only.
Molecular Constructor
Ile245–Ser554

Introduction

Recombinant Human TUBGCP3 protein, also known as gamma-tubulin complex protein 3, is a key component of the gamma-tubulin ring complex (γ-TuRC) that plays a critical role in microtubule nucleation and organization. This highly conserved protein is encoded by the TUBGCP3 gene and is expressed in various tissues and cell types.

Structure of Recombinant Human TUBGCP3 Protein

The recombinant human TUBGCP3 protein is composed of 842 amino acids with a molecular weight of approximately 94 kDa. It contains multiple domains, including a WD40 repeat domain, a GTPase domain, and a coiled-coil domain, which are essential for its function in microtubule nucleation.

The WD40 repeat domain is involved in protein-protein interactions and is responsible for the assembly of the γ-TuRC complex. The GTPase domain, on the other hand, is responsible for the binding of GTP and is essential for the regulation of microtubule nucleation. The coiled-coil domain is responsible for the formation of a stable complex with other components of the γ-TuRC.

Activity of Recombinant Human TUBGCP3 Protein

Recombinant human TUBGCP3 protein plays a crucial role in microtubule nucleation, which is the initial step in the formation of microtubule structures. It acts as a scaffold protein, bringing together other components of the γ-TuRC complex, including gamma-tubulin, to initiate microtubule growth. This process is essential for various cellular functions, such as cell division, cell motility, and intracellular transport.

Additionally, TUBGCP3 has been shown to regulate the number and length of microtubules, thus playing a critical role in maintaining the overall microtubule network and cellular architecture. It also interacts with other proteins involved in microtubule dynamics, such as centrosomal protein 170 (CEP170), to regulate microtubule nucleation and organization.

Application of Recombinant Human TUBGCP3 Protein

The recombinant human TUBGCP3 protein has various applications in both basic research and clinical settings. Its role in microtubule nucleation and organization makes it a crucial tool for studying the mechanisms of cell division, cell motility, and intracellular transport.

Furthermore, TUBGCP3 has been implicated in several diseases, including cancer and neurodegenerative disorders, making it a potential therapeutic target. Recombinant TUBGCP3 protein can be used to screen for potential drug candidates that target its activity and disrupt microtubule dynamics in disease conditions.

Moreover, recombinant TUBGCP3 protein can also be used as an antigen for the production of specific antibodies. These antibodies can be used for various applications, such as immunostaining and western blotting, to study the expression and localization of TUBGCP3 in different tissues and cell types.

Conclusion

In summary, recombinant human TUBGCP3 protein is a crucial component of the γ-TuRC complex that plays a critical role in microtubule nucleation and organization. Its unique structure and activity make it an essential tool for studying cellular processes and potential therapeutic target for various diseases. With its multiple applications, recombinant TUBGCP3 protein continues to be a valuable asset in the field of cell biology and biomedical research.

Recombinant Human TUBGCP3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TUBGCP3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products