Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TXN, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P10599
Molecular weight:
13.92 kDa

Original price was: $308.00.Current price is: $265.00.

50ug 14% OFF + 265 loyalty points
His Val2–Val105
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TXN, N-His

Product name ARO-P13718-100
Uniprot ID P10599
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Molecular weight 13.92 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val2-Val105
Aliases /Synonyms Trx, TXN, TRX1, SASP, Hom s Trx, Thioredoxin, ATL-derived factor, ADF, TRX, Surface-associated sulphydryl protein, TRDX
Reference ARO-P13718
Note For research use only.
Molecular Constructor
His Val2–Val105
Product name ARO-P13718-1MG
Uniprot ID P10599
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Molecular weight 13.92 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val2-Val105
Aliases /Synonyms Trx, TXN, TRX1, SASP, Hom s Trx, Thioredoxin, ATL-derived factor, ADF, TRX, Surface-associated sulphydryl protein, TRDX
Reference ARO-P13718
Note For research use only.
Molecular Constructor
His Val2–Val105
Product name ARO-P13718-50
Uniprot ID P10599
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Molecular weight 13.92 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val2-Val105
Aliases /Synonyms Trx, TXN, TRX1, SASP, Hom s Trx, Thioredoxin, ATL-derived factor, ADF, TRX, Surface-associated sulphydryl protein, TRDX
Reference ARO-P13718
Note For research use only.
Molecular Constructor
His Val2–Val105

Recombinant Human TXN, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TXN, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products