Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human VPS8 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8N3P4
Molecular weight:
19.79 kDa

Original price was: $409.00.Current price is: $327.00.

100ug 20% OFF + 327 loyalty points
Val819–Glu966
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human VPS8 Protein, N-His

Product name ARO-P10728-100
Uniprot ID Q8N3P4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VMVENSDFTPSQVGCLFTFLARQLAKPDNTLFVNRTLFDQVLEFLCSPDDDSRHSERQQVLLELLQAGGIVQFEESRLIRMAEKAEFYQICEFMYEREHQYDKIIDCYLRDPLREEEVFNYIHNILSIPGHSAEEKQSVWQKAMDHIE
Molecular weight 19.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val819-Glu966
Aliases /Synonyms VPS8, KIAA0804, Vacuolar protein sorting-associated protein 8 homolog
Reference ARO-P10728
Note For research use only.
Molecular Constructor
Val819–Glu966
Product name ARO-P10728-1MG
Uniprot ID Q8N3P4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VMVENSDFTPSQVGCLFTFLARQLAKPDNTLFVNRTLFDQVLEFLCSPDDDSRHSERQQVLLELLQAGGIVQFEESRLIRMAEKAEFYQICEFMYEREHQYDKIIDCYLRDPLREEEVFNYIHNILSIPGHSAEEKQSVWQKAMDHIE
Molecular weight 19.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val819-Glu966
Aliases /Synonyms VPS8, KIAA0804, Vacuolar protein sorting-associated protein 8 homolog
Reference ARO-P10728
Note For research use only.
Molecular Constructor
Val819–Glu966
Product name ARO-P10728-50
Uniprot ID Q8N3P4
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VMVENSDFTPSQVGCLFTFLARQLAKPDNTLFVNRTLFDQVLEFLCSPDDDSRHSERQQVLLELLQAGGIVQFEESRLIRMAEKAEFYQICEFMYEREHQYDKIIDCYLRDPLREEEVFNYIHNILSIPGHSAEEKQSVWQKAMDHIE
Molecular weight 19.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val819-Glu966
Aliases /Synonyms VPS8, KIAA0804, Vacuolar protein sorting-associated protein 8 homolog
Reference ARO-P10728
Note For research use only.
Molecular Constructor
Val819–Glu966

Introduction

Recombinant Human VPS8 Protein, also known as Vacuolar Protein Sorting 8 Homolog, is a protein that plays a crucial role in the process of intracellular trafficking and protein sorting. It is a key component of the endosomal sorting complex required for transport (ESCRT) pathway, which is responsible for the sorting and delivery of proteins to the appropriate cellular compartments. In this article, we will discuss the structure, activity, and applications of Recombinant Human VPS8 Protein.

Structure of Recombinant Human VPS8 Protein

Recombinant Human VPS8 Protein is a 121 kDa protein composed of 1080 amino acids. It contains a central VPS8 domain, which is highly conserved among all species, and is responsible for its function in the ESCRT pathway. The protein also contains several other domains, including a C-terminal MIT domain, a C2 domain, and a proline-rich region. These domains are involved in protein-protein interactions and play a crucial role in the recruitment of other ESCRT components.

Activity of Recombinant Human VPS8 Protein

Recombinant Human VPS8 Protein is primarily involved in the sorting of ubiquitinated membrane proteins into multivesicular bodies (MVBs) for degradation. This process is essential for maintaining the homeostasis of the cell and preventing the accumulation of damaged or unwanted proteins. VPS8 interacts with other ESCRT components, such as VPS4, VPS25, and VPS36, to form the ESCRT-III complex, which is responsible for the formation of intraluminal vesicles (ILVs) within MVBs. These ILVs contain the sorted proteins and are eventually released into the lysosome for degradation.

In addition to its role in protein sorting, Recombinant Human VPS8 Protein also plays a crucial role in cytokinesis, the process of cell division. It is involved in the formation of the midbody, a structure that helps to physically separate the two daughter cells during cytokinesis. VPS8 interacts with other ESCRT components to form the midbody ring, which is essential for the completion of cytokinesis.

Applications of Recombinant Human VPS8 Protein

Recombinant Human VPS8 Protein has a wide range of applications in both research and therapeutic settings. Its role in the ESCRT pathway makes it a valuable tool for studying protein sorting and intracellular trafficking. It can be used in in vitro and in vivo experiments to investigate the function of the ESCRT pathway and its involvement in various cellular processes.

Furthermore, Recombinant Human VPS8 Protein has potential therapeutic applications. Mutations in the gene encoding VPS8 have been linked to neurodegenerative diseases, such as Parkinson’s and Alzheimer’s disease. Therefore, understanding the structure and function of VPS8 can aid in the development of targeted therapies for these diseases.

Additionally, Recombinant Human VPS8 Protein can be used as an antigen in the production of antibodies for research and diagnostic purposes. It can also be used in vaccine development, as it has been shown to induce a strong immune response in animal models.

Conclusion

In conclusion, Recombinant Human VPS8 Protein is a key component of the ESCRT pathway, involved in protein sorting and cytokinesis. Its structure and function make it a valuable tool for studying intracellular trafficking and protein degradation. It also has potential therapeutic applications and can be used as an antigen in the production of antibodies and vaccines. Further research on Recombinant Human VPS8 Protein may lead to a better understanding of its role in various cellular processes and the development of targeted therapies for diseases associated with its dysfunction.

Recombinant Human VPS8 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human VPS8 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products