Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human WBP2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q969T9
Molecular weight:
17.04 kDa

Original price was: $267.00.Current price is: $230.00.

50ug 14% OFF + 230 loyalty points
Met1–Gly136
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human WBP2 Protein, N-His

Product name ARO-P12121-100
Uniprot ID Q969T9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRG
Molecular weight 17.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly136
Aliases /Synonyms WBP-2, WW domain-binding protein 2, WBP2
Reference ARO-P12121
Note For research use only.
Molecular Constructor
Met1–Gly136
Product name ARO-P12121-1MG
Uniprot ID Q969T9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRG
Molecular weight 17.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly136
Aliases /Synonyms WBP-2, WW domain-binding protein 2, WBP2
Reference ARO-P12121
Note For research use only.
Molecular Constructor
Met1–Gly136
Product name ARO-P12121-50
Uniprot ID Q969T9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRG
Molecular weight 17.04 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly136
Aliases /Synonyms WBP-2, WW domain-binding protein 2, WBP2
Reference ARO-P12121
Note For research use only.
Molecular Constructor
Met1–Gly136

Introduction to Recombinant Human WBP2 Protein

Recombinant Human WBP2 Protein, also known as WW domain-binding protein 2, is a protein that plays a crucial role in various cellular processes such as cell proliferation, differentiation, and apoptosis. This protein is encoded by the WBP2 gene and is highly conserved among different species. Recombinant Human WBP2 Protein is produced through genetic engineering techniques, making it a valuable tool in various research and industrial applications.

Structure of Recombinant Human WBP2 Protein

Recombinant Human WBP2 Protein is a 62 kDa protein that consists of 555 amino acids. It contains two WW domains, which are protein modules that are known to interact with proline-rich motifs in other proteins. The WW domains of Recombinant Human WBP2 Protein play a significant role in its binding to other proteins, making it a crucial component in various signaling pathways.

In addition to its WW domains, Recombinant Human WBP2 Protein also contains a proline-rich region and an SH3 domain. These domains are involved in protein-protein interactions and are essential for the proper functioning of this protein.

Activity of Recombinant Human WBP2 Protein

Recombinant Human WBP2 Protein is a multifunctional protein that is involved in various cellular processes. One of its main functions is its role in the regulation of cell proliferation and differentiation. Studies have shown that Recombinant Human WBP2 Protein can interact with other proteins involved in these processes, such as the tumor suppressor protein p53 and the transcription factor E2F1.

Moreover, Recombinant Human WBP2 Protein has been found to play a crucial role in the regulation of apoptosis. It can interact with proteins involved in the apoptotic pathway, such as Bcl-2 and Bax, and modulate their activity, thus influencing cell survival or death.

Another important activity of Recombinant Human WBP2 Protein is its involvement in the regulation of gene expression. It can interact with transcription factors and co-activators and modulate their activity, thus influencing the expression of specific genes.

Applications of Recombinant Human WBP2 Protein

Recombinant Human WBP2 Protein has various applications in both research and industrial settings. One of its main applications is in the study of cellular processes and signaling pathways. Its ability to interact with other proteins and modulate their activity makes it a valuable tool for understanding the underlying mechanisms of various cellular processes.

In addition, Recombinant Human WBP2 Protein has been used in the development of diagnostic tools for various diseases. It has been found to be overexpressed in certain types of cancer, making it a potential biomarker for cancer diagnosis and prognosis.

Furthermore, Recombinant Human WBP2 Protein has been used in the development of therapeutic agents for cancer treatment. Its involvement in the regulation of cell proliferation and apoptosis makes it a potential target for anti-cancer drugs.

Recombinant Human WBP2 Protein has also been used in the production of biopharmaceuticals. Its ability to interact with other proteins and modulate their activity makes it a valuable component in the development of protein-based drugs.

Conclusion

In conclusion, Recombinant Human WBP2 Protein is a crucial protein that plays a significant role in various cellular processes. Its structure, activity, and applications make it a valuable tool in both research and industrial settings. With further studies and advancements in genetic engineering techniques, Recombinant Human WBP2 Protein has the potential to be used in the development of new diagnostic tools and therapeutic agents for various diseases.

Recombinant Human WBP2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human WBP2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products