Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human WDR24 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96S15
Molecular weight:
23.93 kDa

Original price was: $296.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Glu57–Thr158
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human WDR24 Protein, N-His-SUMO

Product name ARO-P11622-100
Uniprot ID Q96S15
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EQFVEKLNLRVGRKPSLNLSCADVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHKRTVNKVCFHPTEAHVLLSGSQDGFMKCFDLRRKDSVST
Molecular weight 23.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu57-Thr158
Aliases /Synonyms WDR24, C16orf21, GATOR complex protein WDR24, WD repeat-containing protein 24
Reference ARO-P11622
Note For research use only.
Molecular Constructor
Glu57–Thr158
Product name ARO-P11622-1MG
Uniprot ID Q96S15
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EQFVEKLNLRVGRKPSLNLSCADVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHKRTVNKVCFHPTEAHVLLSGSQDGFMKCFDLRRKDSVST
Molecular weight 23.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu57-Thr158
Aliases /Synonyms WDR24, C16orf21, GATOR complex protein WDR24, WD repeat-containing protein 24
Reference ARO-P11622
Note For research use only.
Molecular Constructor
Glu57–Thr158
Product name ARO-P11622-50
Uniprot ID Q96S15
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence EQFVEKLNLRVGRKPSLNLSCADVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHKRTVNKVCFHPTEAHVLLSGSQDGFMKCFDLRRKDSVST
Molecular weight 23.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu57-Thr158
Aliases /Synonyms WDR24, C16orf21, GATOR complex protein WDR24, WD repeat-containing protein 24
Reference ARO-P11622
Note For research use only.
Molecular Constructor
Glu57–Thr158

Introduction

Recombinant Human WDR24 Protein is a highly sought-after protein in the field of molecular biology and biochemistry. This protein is a member of the WD repeat-containing protein family, which plays a crucial role in various cellular processes such as transcription, translation, and cell cycle regulation. In this article, we will discuss the structure, activity, and applications of Recombinant Human WDR24 Protein.

Structure of Recombinant Human WDR24 Protein

Recombinant Human WDR24 Protein is a 60 kDa protein consisting of 551 amino acids. It contains seven WD40 repeats, which are structural motifs found in a variety of proteins involved in protein-protein interactions. These repeats form a beta-propeller structure, which is responsible for the protein’s ability to interact with other proteins and nucleic acids.

Activity of Recombinant Human WDR24 Protein

Recombinant Human WDR24 Protein is involved in multiple cellular processes, including transcription, translation, and cell cycle regulation. It has been shown to interact with various transcription factors and co-activators, suggesting its role in gene expression. Additionally, this protein has been found to interact with ribosomal proteins, indicating its involvement in protein synthesis.

One of the most intriguing activities of Recombinant Human WDR24 Protein is its role in the regulation of the cell cycle. It has been shown to interact with the tumor suppressor protein p53 and regulate its activity, thereby affecting cell cycle progression and cell growth. This highlights the potential importance of this protein in cancer research.

Application of Recombinant Human WDR24 Protein

Recombinant Human WDR24 Protein has a wide range of applications in the field of molecular biology and biochemistry. One of the primary uses of this protein is in protein-protein interaction studies. Its ability to interact with various proteins and nucleic acids makes it a valuable tool for understanding complex cellular processes.

Another important application of Recombinant Human WDR24 Protein is in gene expression studies. Its interaction with transcription factors and co-activators suggests its involvement in gene regulation, making it a valuable tool for studying gene expression.

Furthermore, Recombinant Human WDR24 Protein has potential applications in cancer research. Its role in cell cycle regulation and interaction with the tumor suppressor protein p53 make it a promising target for the development of anti-cancer therapies.

Conclusion

In summary, Recombinant Human WDR24 Protein is a 60 kDa protein with seven WD40 repeats, involved in various cellular processes such as transcription, translation, and cell cycle regulation. Its ability to interact with other proteins and nucleic acids makes it a valuable tool for studying protein-protein interactions and gene expression. Additionally, its potential role in cancer research makes it an important protein for further investigation. With its diverse applications, Recombinant Human WDR24 Protein is a highly sought-after protein in the field of molecular biology and biochemistry.

Recombinant Human WDR24 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human WDR24 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products