Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human WDR45 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y484
Molecular weight:
20.40 kDa

Original price was: $347.00.Current price is: $274.00.

50ug 21% OFF + 274 loyalty points
Cys23–Ala184
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human WDR45 Protein, N-His

Product name ARO-P12129-100
Uniprot ID Q9Y484
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CAMETGVRIYNVEPLMEKGHLDHEQVGSMGLVEMLHRSNLLALVGGGSSPKFSEISVLIWDDAREGKDSKEKLVLEFTFTKPVLSVRMRHDKIVIVLKNRIYVYSFPDNPRKLFEFDTRDNPKGLCDLCPSLEKQLLVFPGHKCGSLQLVDLASTKPGTSSA
Molecular weight 20.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys23-Ala184
Aliases /Synonyms WD repeat-containing protein 45, WD repeat domain phosphoinositide-interacting protein 4, WDR45, WDRX1, WDRXI4, WIPI-4, WIPI4
Reference ARO-P12129
Note For research use only.
Molecular Constructor
Cys23–Ala184
Product name ARO-P12129-1MG
Uniprot ID Q9Y484
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CAMETGVRIYNVEPLMEKGHLDHEQVGSMGLVEMLHRSNLLALVGGGSSPKFSEISVLIWDDAREGKDSKEKLVLEFTFTKPVLSVRMRHDKIVIVLKNRIYVYSFPDNPRKLFEFDTRDNPKGLCDLCPSLEKQLLVFPGHKCGSLQLVDLASTKPGTSSA
Molecular weight 20.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys23-Ala184
Aliases /Synonyms WD repeat-containing protein 45, WD repeat domain phosphoinositide-interacting protein 4, WDR45, WDRX1, WDRXI4, WIPI-4, WIPI4
Reference ARO-P12129
Note For research use only.
Molecular Constructor
Cys23–Ala184
Product name ARO-P12129-50
Uniprot ID Q9Y484
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence CAMETGVRIYNVEPLMEKGHLDHEQVGSMGLVEMLHRSNLLALVGGGSSPKFSEISVLIWDDAREGKDSKEKLVLEFTFTKPVLSVRMRHDKIVIVLKNRIYVYSFPDNPRKLFEFDTRDNPKGLCDLCPSLEKQLLVFPGHKCGSLQLVDLASTKPGTSSA
Molecular weight 20.40 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Cys23-Ala184
Aliases /Synonyms WD repeat-containing protein 45, WD repeat domain phosphoinositide-interacting protein 4, WDR45, WDRX1, WDRXI4, WIPI-4, WIPI4
Reference ARO-P12129
Note For research use only.
Molecular Constructor
Cys23–Ala184

Introduction

Recombinant Human WDR45 Protein, also known as WIPI4 or ATG18, is a protein that plays a critical role in autophagy, the process by which cells break down and recycle damaged or unnecessary components. This protein is encoded by the WDR45 gene and is highly conserved across species, indicating its importance in cellular function. In this article, we will explore the structure, activity, and applications of Recombinant Human WDR45 Protein.

Structure of Recombinant Human WDR45 Protein

Recombinant Human WDR45 Protein is a 43 kDa protein composed of 381 amino acids. It contains a WD repeat domain, which is a common structural motif found in many proteins involved in various cellular processes. This domain consists of approximately 40 amino acids and is characterized by four conserved tryptophan (W) and aspartic acid (D) residues, hence the name WD repeat. The WD repeat domain of WDR45 is essential for its interaction with other proteins involved in autophagy, such as ATG2 and ATG18.

Activity of Recombinant Human WDR45 Protein

Recombinant Human WDR45 Protein is a key regulator of autophagy, a cellular process that maintains cellular homeostasis by degrading and recycling damaged or unnecessary components. Autophagy is essential for various cellular functions, including development, differentiation, and response to stress. WDR45 is involved in the formation of autophagosomes, the structures that engulf and transport cellular components to the lysosome for degradation. It does so by interacting with other proteins, such as ATG2 and ATG18, to regulate the initiation and elongation of the autophagosome membrane.

Additionally, WDR45 is also involved in the selective autophagy of damaged mitochondria, a process known as mitophagy. This is crucial for maintaining cellular energy production and preventing the accumulation of damaged mitochondria, which can lead to cell death. WDR45 interacts with another protein, NIX, to promote mitophagy and maintain cellular homeostasis.

Applications of Recombinant Human WDR45 Protein

Recombinant Human WDR45 Protein has several potential applications in the field of autophagy research. It can be used as an antigen to produce antibodies for studying the expression and localization of WDR45 in different tissues and cell types. These antibodies can also be used to investigate the role of WDR45 in autophagy and its interaction with other proteins involved in this process.

Furthermore, recombinant WDR45 protein can be used to study the structure and function of the WD repeat domain and its role in protein-protein interactions. This can aid in the development of drugs that target the WD repeat domain of WDR45 and other proteins involved in autophagy, potentially leading to new treatments for autophagy-related diseases.

Moreover, the dysregulation of autophagy has been implicated in various diseases, such as cancer, neurodegenerative disorders, and metabolic disorders. Recombinant Human WDR45 Protein can be used in studies to understand the role of autophagy in these diseases, potentially leading to the development of new therapies.

Conclusion

Recombinant Human WDR45 Protein is a crucial player in the process of autophagy, with its WD repeat domain being essential for its function. It is involved in the formation of autophagosomes and the selective degradation of damaged mitochondria. The use of recombinant WDR45 protein in research has the potential to advance our understanding of autophagy and its role in various diseases, leading to the development of new treatments.

Recombinant Human WDR45 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human WDR45 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products