Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human XKR8, N-His & N-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H6D3
Molecular weight:
22.80 kDa

Original price was: $259.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Arg69–Arg158
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human XKR8, N-His & N-SUMO

Product name ARO-P13103-100
Uniprot ID Q9H6D3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RADPAGLHGSQPPRRCLALLHLLQLGYLYRCVQELRQGLLVWQQEEPSEFDLAYADFLALDISMLRLFETFLETAPQLTLVLAIMLQSGR
Molecular weight 22.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg69-Arg158
Aliases /Synonyms hXkr8, XKR8, XK-related protein 8, XRG8
Reference ARO-P13103
Note For research use only.
Molecular Constructor
Arg69–Arg158
Product name ARO-P13103-1MG
Uniprot ID Q9H6D3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RADPAGLHGSQPPRRCLALLHLLQLGYLYRCVQELRQGLLVWQQEEPSEFDLAYADFLALDISMLRLFETFLETAPQLTLVLAIMLQSGR
Molecular weight 22.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg69-Arg158
Aliases /Synonyms hXkr8, XKR8, XK-related protein 8, XRG8
Reference ARO-P13103
Note For research use only.
Molecular Constructor
Arg69–Arg158
Product name ARO-P13103-50
Uniprot ID Q9H6D3
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence RADPAGLHGSQPPRRCLALLHLLQLGYLYRCVQELRQGLLVWQQEEPSEFDLAYADFLALDISMLRLFETFLETAPQLTLVLAIMLQSGR
Molecular weight 22.80 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg69-Arg158
Aliases /Synonyms hXkr8, XKR8, XK-related protein 8, XRG8
Reference ARO-P13103
Note For research use only.
Molecular Constructor
Arg69–Arg158

Introduction

Recombinant Human XKR8 is a protein that has gained significant attention in the field of biotechnology due to its unique structure and diverse functionality. In this article, we will explore the structure, activity, and applications of this recombinant protein.

Structure of Recombinant Human XKR8

Recombinant Human XKR8 is a 48-kDa protein that belongs to the XKR family. It is composed of 422 amino acids and has a predicted molecular weight of approximately 48 kDa. The protein contains a conserved XKR domain, which is essential for its function.

The XKR domain is a transmembrane domain that is responsible for the localization of the protein to the cell membrane. It is also involved in protein-protein interactions and plays a crucial role in the activity of Recombinant Human XKR8.

Furthermore, Recombinant Human XKR8 has a unique structure with three extracellular loops and two intracellular loops. These loops are involved in the binding of ligands and signaling molecules, making Recombinant Human XKR8 a versatile protein with multiple functions.

Activity of Recombinant Human XKR8

The primary function of Recombinant Human XKR8 is to act as a cell surface receptor. It is involved in various cellular processes such as cell proliferation, differentiation, and apoptosis. The protein is activated by the binding of specific ligands, which triggers a signaling cascade leading to the activation of downstream pathways.

Studies have shown that Recombinant Human XKR8 is highly expressed in various tissues, including the brain, heart, and immune cells. This suggests its crucial role in regulating cellular functions and maintaining tissue homeostasis.

Moreover, Recombinant Human XKR8 has been found to play a role in the regulation of immune responses. It modulates the activity of immune cells, such as T cells and natural killer cells, by regulating their proliferation and activation. This makes it a potential target for immunotherapy and treatment of autoimmune diseases.

Applications of Recombinant Human XKR8

The unique structure and diverse functionality of Recombinant Human XKR8 make it a promising protein for various applications in the field of biotechnology and medicine. Some of its potential applications include:

1. Recombinant Protein Production

Recombinant Human XKR8 can be produced in large quantities using recombinant DNA technology. This makes it an essential protein for research purposes and the development of therapeutic agents.

2. Biomarker for Cancer

Studies have shown that Recombinant Human XKR8 is overexpressed in various types of cancer, including breast, lung, and colon cancer. This makes it a potential biomarker for cancer diagnosis and a target for cancer therapy.

3. Immunotherapy

Recombinant Human XKR8 has been found to play a role in regulating immune responses. This makes it a potential target for immunotherapy, particularly in the treatment of autoimmune diseases and cancer.

4. Drug Development

The unique structure and function of Recombinant Human XKR8 make it a potential target for drug development. Researchers are exploring its role in various diseases and developing drugs that can modulate its activity for therapeutic purposes.

5. Research Tool

Recombinant Human XKR8 is a valuable research tool for studying cell signaling and protein-protein interactions. Its ability to modulate cellular functions makes it an

Recombinant Human XKR8, N-His & N-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human XKR8, N-His & N-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products