Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human XRCC5/Ku80, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P13010

Original price was: $353.00.Current price is: $274.00.

50ug 22% OFF + 274 loyalty points
His Leu384–Ile732
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human XRCC5/Ku80, N-His

Product name ARO-P14031-100
Uniprot ID P13010
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
Protein delivered with Tag? N-Terminal His Tag
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu384-Ile732
Aliases /Synonyms Lupus Ku autoantigen protein p86, XRCC5, Thyroid-lupus autoantigen, Ku86, ATP-dependent DNA helicase 2 subunit 2, CTC85, G22P2, DNA repair protein XRCC5, 86 kDa subunit of Ku antigen, TLAA, Nuclear factor IV, CTC box-binding factor 85 kDa subunit, ATP-dependent DNA helicase II 80 kDa subunit, CTCBF, Ku80, X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining), X-ray repair cross-complementing protein 5
Reference ARO-P14031
Note For research use only.
Molecular Constructor
His Leu384–Ile732
Product name ARO-P14031-1MG
Uniprot ID P13010
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
Protein delivered with Tag? N-Terminal His Tag
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu384-Ile732
Aliases /Synonyms Lupus Ku autoantigen protein p86, XRCC5, Thyroid-lupus autoantigen, Ku86, ATP-dependent DNA helicase 2 subunit 2, CTC85, G22P2, DNA repair protein XRCC5, 86 kDa subunit of Ku antigen, TLAA, Nuclear factor IV, CTC box-binding factor 85 kDa subunit, ATP-dependent DNA helicase II 80 kDa subunit, CTCBF, Ku80, X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining), X-ray repair cross-complementing protein 5
Reference ARO-P14031
Note For research use only.
Molecular Constructor
His Leu384–Ile732
Product name ARO-P14031-50
Uniprot ID P13010
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
Protein delivered with Tag? N-Terminal His Tag
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu384-Ile732
Aliases /Synonyms Lupus Ku autoantigen protein p86, XRCC5, Thyroid-lupus autoantigen, Ku86, ATP-dependent DNA helicase 2 subunit 2, CTC85, G22P2, DNA repair protein XRCC5, 86 kDa subunit of Ku antigen, TLAA, Nuclear factor IV, CTC box-binding factor 85 kDa subunit, ATP-dependent DNA helicase II 80 kDa subunit, CTCBF, Ku80, X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining), X-ray repair cross-complementing protein 5
Reference ARO-P14031
Note For research use only.
Molecular Constructor
His Leu384–Ile732

Recombinant Human XRCC5/Ku80, N-His

There are no reviews yet.

Be the first to review “Recombinant Human XRCC5/Ku80, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products