Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ZBP1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9H171
Molecular weight:
20.20 kDa

Original price was: $296.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Arg10–Pro167
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ZBP1, N-His

Product name ARO-P13115-100
Uniprot ID Q9H171
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIYRP
Molecular weight 20.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg10-Pro167
Aliases /Synonyms DNA-dependent activator of IFN-regulatory factors, DLM1, ZBP1, C20orf183, Z-DNA-binding protein 1, DAI, Tumor stroma and activated macrophage protein DLM-1
Reference ARO-P13115
Note For research use only.
Molecular Constructor
Arg10–Pro167
Product name ARO-P13115-1MG
Uniprot ID Q9H171
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIYRP
Molecular weight 20.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg10-Pro167
Aliases /Synonyms DNA-dependent activator of IFN-regulatory factors, DLM1, ZBP1, C20orf183, Z-DNA-binding protein 1, DAI, Tumor stroma and activated macrophage protein DLM-1
Reference ARO-P13115
Note For research use only.
Molecular Constructor
Arg10–Pro167
Product name ARO-P13115-50
Uniprot ID Q9H171
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence REGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIYRP
Molecular weight 20.20 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Arg10-Pro167
Aliases /Synonyms DNA-dependent activator of IFN-regulatory factors, DLM1, ZBP1, C20orf183, Z-DNA-binding protein 1, DAI, Tumor stroma and activated macrophage protein DLM-1
Reference ARO-P13115
Note For research use only.
Molecular Constructor
Arg10–Pro167

Introduction to Recombinant Human ZBP1

Recombinant Human ZBP1, also known as Z-DNA binding protein 1, is a protein that plays a crucial role in the innate immune response. It is a member of the Z-DNA binding protein family and is highly conserved across species, indicating its important biological function. In this article, we will explore the structure, activity, and applications of Recombinant Human ZBP1.

Structure of Recombinant Human ZBP1

Recombinant Human ZBP1 is a 75 kDa protein that consists of 673 amino acids. It contains three domains: an N-terminal DZD domain, a central zinc finger domain, and a C-terminal death domain. The DZD domain is responsible for binding to Z-DNA, while the zinc finger domain is involved in protein-protein interactions. The death domain is essential for signaling and activation of downstream pathways.

Recombinant Human ZBP1 is produced through recombinant protein technology, where the gene encoding for ZBP1 is cloned and expressed in a host cell. This allows for the production of large quantities of pure and functional ZBP1 protein for research and therapeutic purposes.

Activity of Recombinant Human ZBP1

Recombinant Human ZBP1 is a key player in the immune response to viral and bacterial infections. It is primarily expressed in immune cells, such as macrophages and dendritic cells, and is activated upon recognition of foreign nucleic acids. ZBP1 has been shown to bind to Z-DNA, a structure that is formed when DNA is under stress, such as during viral infection. This binding triggers a signaling cascade that leads to the production of pro-inflammatory cytokines, such as interferons and tumor necrosis factor (TNF).

In addition to its role in the immune response, Recombinant Human ZBP1 has also been shown to play a role in cell death. It can induce a type of programmed cell death known as pyroptosis, which is important for eliminating infected cells and preventing the spread of infection.

Applications of Recombinant Human ZBP1

The unique structure and activity of Recombinant Human ZBP1 make it a valuable tool for research and potential therapeutic applications. Its ability to recognize and respond to foreign nucleic acids makes it a promising target for antiviral and antibacterial therapies. In fact, recent studies have shown that ZBP1 is essential for the antiviral response against several viruses, including influenza and herpes simplex virus.

Furthermore, Recombinant Human ZBP1 has been shown to have potential in cancer therapy. It has been found to be highly expressed in certain types of cancer, and its activation has been shown to induce cancer cell death. This makes ZBP1 an attractive target for developing novel cancer treatments.

Recombinant Human ZBP1 is also a valuable tool for studying the innate immune response. Its ability to bind to Z-DNA and activate downstream signaling pathways allows for the investigation of the mechanisms involved in immune recognition and response to foreign nucleic acids.

Conclusion

In summary, Recombinant Human ZBP1 is a crucial protein involved in the innate immune response. Its unique structure and activity make it a valuable tool for research and potential therapeutic applications. As our understanding of ZBP1 continues to grow, we can expect to see further advancements in the development of antiviral, antibacterial, and cancer therapies.

Recombinant Human ZBP1, N-His

There are no reviews yet.

Be the first to review “Recombinant Human ZBP1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products