Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human ZEB2 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O60315
Molecular weight:
35.15 kDa

Original price was: $280.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Ser647–Ser705
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human ZEB2 Protein, N-GST & C-His

Product name ARO-P12594-100
Uniprot ID O60315
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPINPYKDHMSVLKAYYAMNMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQYSNSRS
Molecular weight 35.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser647-Ser705
Aliases /Synonyms Smad-interacting protein 1, SIP1, SMADIP1, ZFX1B, KIAA0569, ZEB2, Zinc finger E-box-binding homeobox 2, ZFHX1B, Zinc finger homeobox protein 1b
Reference ARO-P12594
Note For research use only.
Molecular Constructor
Ser647–Ser705
Product name ARO-P12594-1MG
Uniprot ID O60315
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPINPYKDHMSVLKAYYAMNMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQYSNSRS
Molecular weight 35.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser647-Ser705
Aliases /Synonyms Smad-interacting protein 1, SIP1, SMADIP1, ZFX1B, KIAA0569, ZEB2, Zinc finger E-box-binding homeobox 2, ZFHX1B, Zinc finger homeobox protein 1b
Reference ARO-P12594
Note For research use only.
Molecular Constructor
Ser647–Ser705
Product name ARO-P12594-50
Uniprot ID O60315
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SPINPYKDHMSVLKAYYAMNMEPNSDELLKISIAVGLPQEFVKEWFEQRKVYQYSNSRS
Molecular weight 35.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser647-Ser705
Aliases /Synonyms Smad-interacting protein 1, SIP1, SMADIP1, ZFX1B, KIAA0569, ZEB2, Zinc finger E-box-binding homeobox 2, ZFHX1B, Zinc finger homeobox protein 1b
Reference ARO-P12594
Note For research use only.
Molecular Constructor
Ser647–Ser705

Title: Introduction to Recombinant Human ZEB2 Protein

Recombinant Human ZEB2 Protein, also known as Zinc finger E-box-binding homeobox 2, is a transcription factor that plays a crucial role in regulating gene expression and cellular processes. This protein is produced through recombinant DNA technology, making it a valuable tool for research and various applications in the field of biotechnology.

Structure of Recombinant Human ZEB2 Protein

Recombinant Human ZEB2 Protein is composed of 1276 amino acids and has a molecular weight of approximately 145 kDa. It contains two distinct functional domains: a zinc finger domain and a homeodomain. The zinc finger domain is responsible for DNA binding, while the homeodomain is involved in protein-protein interactions. These domains allow ZEB2 to regulate gene expression by binding to specific DNA sequences and interacting with other proteins.

Activity of Recombinant Human ZEB2 Protein

Recombinant Human ZEB2 Protein has been shown to play a critical role in various cellular processes, including cell proliferation, differentiation, and migration. It acts as a transcriptional repressor, meaning it can inhibit the expression of certain genes by binding to their regulatory regions. ZEB2 has been found to regulate the expression of genes involved in epithelial-mesenchymal transition (EMT), a process that is crucial for embryonic development and wound healing. Dysregulation of ZEB2 has been linked to various diseases, including cancer and neurological disorders.

Application of Recombinant Human ZEB2 Protein

1. Research: Recombinant Human ZEB2 Protein is a valuable tool for studying the role of this transcription factor in various cellular processes. It can be used to investigate the mechanisms of gene regulation, EMT, and other biological processes. Its recombinant nature allows for easy manipulation and customization for specific research needs.

2. Drug Discovery: Dysregulation of ZEB2 has been linked to various diseases, making it a potential target for drug development. Recombinant Human ZEB2 Protein can be used to screen for potential drugs that can modulate its activity and potentially treat diseases such as cancer and neurological disorders.

3. Diagnostic Applications: ZEB2 has been identified as a potential biomarker for certain cancers, including breast and lung cancer. Recombinant Human ZEB2 Protein can be used in diagnostic assays to detect the expression levels of ZEB2 in patient samples, aiding in early detection and treatment of these cancers.

4. Therapeutic Applications: Recombinant Human ZEB2 Protein can also be used as a therapeutic agent. It has been shown to inhibit the growth and invasion of cancer cells by regulating the expression of genes involved in EMT. This makes it a potential candidate for targeted cancer therapies.

5. Vaccine Development: Recombinant Human ZEB2 Protein can be used as an antigen in vaccine development. It has been shown to induce an immune response in animal models, making it a potential target for the development of vaccines against certain diseases.

Conclusion

Recombinant Human ZEB2 Protein is a valuable tool for research and various applications in biotechnology. Its unique structure and activity make it a key player in regulating gene expression and cellular processes. With its potential applications in drug discovery, diagnostics, and therapeutics, this protein holds great promise in advancing our understanding and treatment of various diseases.

Recombinant Human ZEB2 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human ZEB2 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products