Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse ACE2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q8R0I0
Molecular weight:
13.84 kDa

Original price was: $431.00.Current price is: $392.00.

100ug 9% OFF + 392 loyalty points
Ser617–Gly716
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse ACE2 Protein, N-His

Product name ARO-P10488-100
Uniprot ID Q8R0I0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SIKVRISLKSALGANAYEWTNNEMFLFRSSVAYAMRKYFSIIKNQTVPFLEEDVRVSDLKPRVSFYFFVTSPQNVSDVIPRSEVEDAIRMSRGRINDVFG
Molecular weight 13.84 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser617-Gly716
Aliases /Synonyms Angiotensin-converting enzyme homolog, ACE2, ACEH, Metalloprotease MPROT15, Angiotensin-converting enzyme-related carboxypeptidase, Angiotensin-converting enzyme 2, ACE-related carboxypeptidase
Reference ARO-P10488
Note For research use only.
Molecular Constructor
Ser617–Gly716
Product name ARO-P10488-1MG
Uniprot ID Q8R0I0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SIKVRISLKSALGANAYEWTNNEMFLFRSSVAYAMRKYFSIIKNQTVPFLEEDVRVSDLKPRVSFYFFVTSPQNVSDVIPRSEVEDAIRMSRGRINDVFG
Molecular weight 13.84 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser617-Gly716
Aliases /Synonyms Angiotensin-converting enzyme homolog, ACE2, ACEH, Metalloprotease MPROT15, Angiotensin-converting enzyme-related carboxypeptidase, Angiotensin-converting enzyme 2, ACE-related carboxypeptidase
Reference ARO-P10488
Note For research use only.
Molecular Constructor
Ser617–Gly716
Product name ARO-P10488-50
Uniprot ID Q8R0I0
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SIKVRISLKSALGANAYEWTNNEMFLFRSSVAYAMRKYFSIIKNQTVPFLEEDVRVSDLKPRVSFYFFVTSPQNVSDVIPRSEVEDAIRMSRGRINDVFG
Molecular weight 13.84 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser617-Gly716
Aliases /Synonyms Angiotensin-converting enzyme homolog, ACE2, ACEH, Metalloprotease MPROT15, Angiotensin-converting enzyme-related carboxypeptidase, Angiotensin-converting enzyme 2, ACE-related carboxypeptidase
Reference ARO-P10488
Note For research use only.
Molecular Constructor
Ser617–Gly716

Introduction

Recombinant Mouse ACE2 Protein is a highly purified and biologically active protein that plays a crucial role in the renin-angiotensin system. This system is responsible for regulating blood pressure and electrolyte balance in the body. ACE2 (Angiotensin-Converting Enzyme 2) is a membrane-bound protein that is expressed in various tissues, including the lungs, heart, and kidneys. It is also the functional receptor for the SARS-CoV-2 virus, making it a vital protein in the current COVID-19 pandemic. In this article, we will discuss the structure, activity, and applications of Recombinant Mouse ACE2 Protein.

Structure of Recombinant Mouse ACE2 Protein

Recombinant Mouse ACE2 Protein is a 805 amino acid protein with a molecular weight of approximately 90 kDa. It is composed of a single polypeptide chain with a transmembrane domain, an extracellular domain, and an intracellular domain. The extracellular domain is responsible for binding to its ligands, including angiotensin II and the SARS-CoV-2 virus. The intracellular domain is involved in signal transduction and regulation of enzyme activity.

Activity of Recombinant Mouse ACE2 Protein

The main function of Recombinant Mouse ACE2 Protein is to convert angiotensin II, a potent vasoconstrictor, into angiotensin-(1-7), a vasodilator. This conversion helps to maintain blood pressure and electrolyte balance in the body. In addition, ACE2 also plays a role in the regulation of inflammation and fibrosis. It has been shown to have protective effects in various diseases, including acute lung injury, heart failure, and kidney disease.

Moreover, Recombinant Mouse ACE2 Protein is also the functional receptor for the SARS-CoV-2 virus. The virus binds to the ACE2 protein on the surface of host cells, allowing it to enter and infect the cells. This interaction is crucial for the pathogenesis of COVID-19 and has led to the development of therapeutics targeting ACE2 to prevent viral entry.

Applications of Recombinant Mouse ACE2 Protein

Recombinant Mouse ACE2 Protein has a wide range of applications in both research and therapeutics. In research, it is used to study the role of ACE2 in various diseases and to develop new treatments. It is also used as a tool to investigate the interaction between ACE2 and the SARS-CoV-2 virus, which can aid in the development of antiviral therapies.

In therapeutics, Recombinant Mouse ACE2 Protein has shown potential as a treatment for diseases such as acute lung injury, pulmonary hypertension, and heart failure. It has also been investigated as a potential therapy for COVID-19, with several clinical trials currently underway. Additionally, ACE2-based therapeutics, such as soluble ACE2 or ACE2 mimetics, are being developed to block the interaction between the virus and host cells, potentially preventing viral entry and reducing disease severity.

Conclusion

Recombinant Mouse ACE2 Protein is a vital protein in the renin-angiotensin system and plays a crucial role in various diseases, including COVID-19. Its structure, activity, and applications make it a valuable tool for research and a potential therapeutic target for various diseases. Further studies on the role of ACE2 in disease pathogenesis and the development of ACE2-based therapeutics may lead to new treatments and interventions for these conditions.

Recombinant Mouse ACE2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse ACE2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products