Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse AIFM3/AIFL Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q3TY86
Molecular weight:
25.14 kDa

Original price was: $462.00.Current price is: $392.00.

100ug 15% OFF + 392 loyalty points
Ser63–Arg177
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse AIFM3/AIFL Protein, N-His-SUMO

Product name ARO-P12639-100
Uniprot ID Q3TY86
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPQDCVEATVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVTIRASKQALQLQRR
Molecular weight 25.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser63-Arg177
Aliases /Synonyms Apoptosis-inducing factor 3; Apoptosis-inducing factor-like protein; Aifm3; Aifl
Reference ARO-P12639
Note For research use only.
Molecular Constructor
Ser63–Arg177
Product name ARO-P12639-1MG
Uniprot ID Q3TY86
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPQDCVEATVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVTIRASKQALQLQRR
Molecular weight 25.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser63-Arg177
Aliases /Synonyms Apoptosis-inducing factor 3; Apoptosis-inducing factor-like protein; Aifm3; Aifl
Reference ARO-P12639
Note For research use only.
Molecular Constructor
Ser63–Arg177
Product name ARO-P12639-50
Uniprot ID Q3TY86
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPQDCVEATVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVTIRASKQALQLQRR
Molecular weight 25.14 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser63-Arg177
Aliases /Synonyms Apoptosis-inducing factor 3; Apoptosis-inducing factor-like protein; Aifm3; Aifl
Reference ARO-P12639
Note For research use only.
Molecular Constructor
Ser63–Arg177

Recombinant Mouse AIFM3/AIFL Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse AIFM3/AIFL Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products