Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CCL5/RANTES Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P30882
Molecular weight:
20.22 kDa

Original price was: $501.00.Current price is: $392.00.

100ug 22% OFF + 392 loyalty points
Ser24–Ser91
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CCL5/RANTES Protein, N-His-SUMO

Product name ARO-P11130-100
Uniprot ID P30882
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
Molecular weight 20.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser24-Ser91
Aliases /Synonyms TCP228, C-C motif chemokine 5, CCL5, T cell-specific protein P228, D17S136E, Small-inducible cytokine A5, SIS-delta, SCYA5, T-cell-specific protein RANTES, Eosinophil chemotactic cytokine, EoCP
Reference ARO-P11130
Note For research use only.
Molecular Constructor
Ser24–Ser91
Product name ARO-P11130-1MG
Uniprot ID P30882
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
Molecular weight 20.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser24-Ser91
Aliases /Synonyms TCP228, C-C motif chemokine 5, CCL5, T cell-specific protein P228, D17S136E, Small-inducible cytokine A5, SIS-delta, SCYA5, T-cell-specific protein RANTES, Eosinophil chemotactic cytokine, EoCP
Reference ARO-P11130
Note For research use only.
Molecular Constructor
Ser24–Ser91
Product name ARO-P11130-50
Uniprot ID P30882
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
Molecular weight 20.22 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser24-Ser91
Aliases /Synonyms TCP228, C-C motif chemokine 5, CCL5, T cell-specific protein P228, D17S136E, Small-inducible cytokine A5, SIS-delta, SCYA5, T-cell-specific protein RANTES, Eosinophil chemotactic cytokine, EoCP
Reference ARO-P11130
Note For research use only.
Molecular Constructor
Ser24–Ser91

Recombinant Mouse CCL5/RANTES Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Mouse CCL5/RANTES Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products