Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD115/CSF1R Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P09581
Molecular weight:
21.90 kDa

Original price was: $505.00.Current price is: $392.00.

100ug 22% OFF + 392 loyalty points
Val22–Val198
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD115/CSF1R Protein, N-His

Product name ARO-P11020-100
Uniprot ID P09581
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence VIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRV
Molecular weight 21.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val22-Val198
Aliases /Synonyms CSF-1R, CSF-1-R, Macrophage colony-stimulating factor 1 receptor, M-CSF-R, Fms, CSF-1 receptor, CD115, Csf1r, Csfmr, Proto-oncogene c-Fms
Reference ARO-P11020
Note For research use only.
Molecular Constructor
Val22–Val198
Product name ARO-P11020-1MG
Uniprot ID P09581
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence VIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRV
Molecular weight 21.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val22-Val198
Aliases /Synonyms CSF-1R, CSF-1-R, Macrophage colony-stimulating factor 1 receptor, M-CSF-R, Fms, CSF-1 receptor, CD115, Csf1r, Csfmr, Proto-oncogene c-Fms
Reference ARO-P11020
Note For research use only.
Molecular Constructor
Val22–Val198
Product name ARO-P11020-50
Uniprot ID P09581
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence VIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRV
Molecular weight 21.90 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val22-Val198
Aliases /Synonyms CSF-1R, CSF-1-R, Macrophage colony-stimulating factor 1 receptor, M-CSF-R, Fms, CSF-1 receptor, CD115, Csf1r, Csfmr, Proto-oncogene c-Fms
Reference ARO-P11020
Note For research use only.
Molecular Constructor
Val22–Val198

Introduction

Recombinant Mouse CD115/CSF1R Protein is a protein that plays a crucial role in the immune system. It is a type I transmembrane protein that is expressed on the surface of various immune cells, including macrophages, monocytes, and dendritic cells. This protein is also known as Colony-Stimulating Factor 1 Receptor (CSF1R) and is encoded by the Csf1r gene in mice. In this article, we will discuss the structure, activity, and applications of Recombinant Mouse CD115/CSF1R Protein.

Structure of Recombinant Mouse CD115/CSF1R Protein

Recombinant Mouse CD115/CSF1R Protein is a 972 amino acid protein with a molecular weight of approximately 110 kDa. It consists of five domains: an extracellular domain, a transmembrane domain, a juxtamembrane domain, a kinase domain, and a C-terminal tail. The extracellular domain is responsible for ligand binding, while the kinase domain is involved in signal transduction.

The extracellular domain of Recombinant Mouse CD115/CSF1R Protein contains three immunoglobulin-like domains, which are important for receptor dimerization and ligand binding. The transmembrane domain is a hydrophobic region that anchors the protein to the cell membrane. The juxtamembrane domain is a short region that connects the transmembrane domain to the kinase domain and plays a role in regulating receptor activity.

The kinase domain of Recombinant Mouse CD115/CSF1R Protein is responsible for initiating downstream signaling cascades upon ligand binding. It contains all the necessary elements for kinase activity, including ATP- and substrate-binding sites. The C-terminal tail of the protein is involved in receptor internalization and degradation.

Activity of Recombinant Mouse CD115/CSF1R Protein

Recombinant Mouse CD115/CSF1R Protein is the receptor for Colony-Stimulating Factor 1 (CSF-1), a cytokine that regulates the growth, differentiation, and survival of myeloid cells. Upon binding of CSF-1, Recombinant Mouse CD115/CSF1R Protein undergoes dimerization and autophosphorylation, leading to the activation of downstream signaling pathways.

The major downstream signaling pathways activated by Recombinant Mouse CD115/CSF1R Protein include the MAPK/ERK, PI3K/Akt, and JAK/STAT pathways. These pathways play important roles in cell proliferation, survival, and differentiation. Recombinant Mouse CD115/CSF1R Protein also regulates the expression of various genes involved in immune response, inflammation, and tissue repair.

Applications of Recombinant Mouse CD115/CSF1R Protein

Recombinant Mouse CD115/CSF1R Protein has a wide range of applications in both basic research and clinical settings. Here are some of the key applications of this protein:

1. Studying immune cell development and function

Recombinant Mouse CD115/CSF1R Protein is essential for the development and function of immune cells, particularly macrophages and monocytes. Therefore, it is commonly used in studies to understand the role of these cells in various diseases and immune responses.

2. Investigating the role of CSF-1 signaling in cancer

Aberrant activation of CSF-1 signaling has been linked to the development and progression of various cancers. Recombinant Mouse CD115/CSF1R Protein is often used to study the role of this signaling pathway in cancer and to develop potential therapeutic strategies targeting this pathway.

3. Developing immunotherapies

Recombinant Mouse CD115/CSF1R Protein has been used in the development of immunotherapies targeting immune cells, such as macrophages and dendritic cells. These therapies aim to boost the

Recombinant Mouse CD115/CSF1R Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD115/CSF1R Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products