Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD276/B7-H3 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q8VE98
Molecular weight:
25.43 kDa

Original price was: $337.00.Current price is: $274.00.

50ug 19% OFF + 274 loyalty points
Thr26–Gly239
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD276/B7-H3 Protein, N-His

Product name ARO-P11117-100
Uniprot ID Q8VE98
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITG
Molecular weight 25.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr26-Gly239
Aliases /Synonyms Cd276, B7 homolog 3, CD276 antigen, CD276, B7-H3, B7h3, Costimulatory molecule
Reference ARO-P11117
Note For research use only.
Molecular Constructor
Thr26–Gly239
Product name ARO-P11117-1MG
Uniprot ID Q8VE98
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITG
Molecular weight 25.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr26-Gly239
Aliases /Synonyms Cd276, B7 homolog 3, CD276 antigen, CD276, B7-H3, B7h3, Costimulatory molecule
Reference ARO-P11117
Note For research use only.
Molecular Constructor
Thr26–Gly239
Product name ARO-P11117-50
Uniprot ID Q8VE98
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITG
Molecular weight 25.43 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr26-Gly239
Aliases /Synonyms Cd276, B7 homolog 3, CD276 antigen, CD276, B7-H3, B7h3, Costimulatory molecule
Reference ARO-P11117
Note For research use only.
Molecular Constructor
Thr26–Gly239

Introduction

The recombinant mouse CD276/B7-H3 protein is a highly versatile and potent antigen that has been extensively studied for its structural characteristics, activity, and potential applications in various fields of science. This protein is a member of the B7 family of immune checkpoint molecules and plays a crucial role in regulating immune responses.

Structure of Recombinant Mouse CD276/B7-H3 Protein

The recombinant mouse CD276/B7-H3 protein is a type I transmembrane protein with a molecular weight of approximately 60 kDa. It is composed of a single extracellular IgV-like domain, a transmembrane region, and a short cytoplasmic tail. The extracellular domain of CD276 contains two Ig-like domains, which are responsible for its binding to receptors on immune cells.

Activity of Recombinant Mouse CD276/B7-H3 Protein

The main function of recombinant mouse CD276/B7-H3 protein is to regulate T cell-mediated immune responses. It has been found to act as both a co-stimulatory and co-inhibitory molecule, depending on the context of the immune response. When expressed on antigen-presenting cells, CD276 interacts with its receptors on T cells, leading to the activation or suppression of T cell responses.

Moreover, CD276 has also been shown to have a role in tumor immune evasion. It is upregulated on the surface of tumor cells and can inhibit the activity of tumor-infiltrating T cells, thus promoting tumor growth. This makes CD276 an attractive target for cancer immunotherapy.

Applications of Recombinant Mouse CD276/B7-H3 Protein

The recombinant mouse CD276/B7-H3 protein has a wide range of potential applications in the field of immunology and cancer research. Its ability to regulate T cell responses makes it a promising target for the development of immunotherapies for various diseases. Some of the potential applications of this protein are:

  • Cancer Immunotherapy: CD276 is highly expressed on the surface of various types of cancer cells, making it a potential target for cancer immunotherapy. Several studies have shown that targeting CD276 can enhance anti-tumor immune responses and inhibit tumor growth.
  • Autoimmune Diseases: CD276 has been implicated in the development of autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis. Targeting this protein could potentially help in the treatment of these diseases by modulating immune responses.
  • Infectious Diseases: CD276 has been shown to play a role in the immune response against certain infectious diseases, such as tuberculosis and HIV. Targeting this protein could potentially enhance immune responses and aid in the development of vaccines against these diseases.
  • Diagnostic Tool: The recombinant mouse CD276/B7-H3 protein can also be used as a diagnostic tool for various diseases. Its expression on the surface of tumor cells can be used as a biomarker for cancer diagnosis, and its role in autoimmune diseases and infectious diseases can aid in disease diagnosis and monitoring.
  • Research Tool: Recombinant mouse CD276/B7-H3 protein can also be used as a research tool to study the role of CD276 in various biological processes and diseases. Its ability to regulate immune responses makes it a valuable tool for studying the immune system and developing new therapies.

Conclusion

The recombinant mouse CD276/B7-H3 protein is a highly versatile and potent antigen that has a crucial role in regulating immune responses. Its unique structural characteristics and diverse functions make it a promising target for the development of immunotherapies for various diseases. With ongoing research, this protein is expected to have a significant impact on the fields of immunology and cancer research.

Recombinant Mouse CD276/B7-H3 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD276/B7-H3 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products