Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD354/TREM1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q9JKE2
Molecular weight:
14.99 kDa

Original price was: $282.00.Current price is: $230.00.

50ug 18% OFF + 230 loyalty points
Glu26–Lys135
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD354/TREM1 Protein, N-His

Product name ARO-P10459-100
Uniprot ID Q9JKE2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EERYDLVEGQTLTVKCPFNIMKYANSQKAWQRLPDGKEPLTLVVTQRPFTRPSEVHMGKFTLKHDPSEAMLQVQMTDLQVTDSGLYRCVIYHPPNDPVVLFHPVRLVVTK
Molecular weight 14.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu26-Lys135
Aliases /Synonyms TREM1, Triggering receptor expressed on monocytes 1, Triggering receptor expressed on myeloid cells 1, TREM-1, CD354
Reference ARO-P10459
Note For research use only.
Molecular Constructor
Glu26–Lys135
Product name ARO-P10459-1MG
Uniprot ID Q9JKE2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EERYDLVEGQTLTVKCPFNIMKYANSQKAWQRLPDGKEPLTLVVTQRPFTRPSEVHMGKFTLKHDPSEAMLQVQMTDLQVTDSGLYRCVIYHPPNDPVVLFHPVRLVVTK
Molecular weight 14.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu26-Lys135
Aliases /Synonyms TREM1, Triggering receptor expressed on monocytes 1, Triggering receptor expressed on myeloid cells 1, TREM-1, CD354
Reference ARO-P10459
Note For research use only.
Molecular Constructor
Glu26–Lys135
Product name ARO-P10459-50
Uniprot ID Q9JKE2
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence EERYDLVEGQTLTVKCPFNIMKYANSQKAWQRLPDGKEPLTLVVTQRPFTRPSEVHMGKFTLKHDPSEAMLQVQMTDLQVTDSGLYRCVIYHPPNDPVVLFHPVRLVVTK
Molecular weight 14.99 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu26-Lys135
Aliases /Synonyms TREM1, Triggering receptor expressed on monocytes 1, Triggering receptor expressed on myeloid cells 1, TREM-1, CD354
Reference ARO-P10459
Note For research use only.
Molecular Constructor
Glu26–Lys135

Introduction
Recombinant Mouse CD354/TREM1 Protein, also known as Triggering Receptor Expressed on Myeloid Cells 1, is an important protein involved in the regulation of immune responses. This protein is a member of the TREM family, which plays a critical role in the activation and function of immune cells. In this article, we will discuss the structure, activity, and applications of Recombinant Mouse CD354/TREM1 Protein.

Structure of Recombinant Mouse CD354/TREM1 Protein
Recombinant Mouse CD354/TREM1 Protein is a type I transmembrane protein that is expressed on the surface of myeloid cells, such as macrophages and neutrophils. It is composed of an extracellular domain, a transmembrane domain, and a cytoplasmic tail. The extracellular domain contains an immunoglobulin-like domain and a short stalk region, which is responsible for binding to its ligand, TREM1 ligand (TREM1-L). The transmembrane domain anchors the protein to the cell membrane, while the cytoplasmic tail contains a signaling motif that activates downstream signaling pathways.

Activity of Recombinant Mouse CD354/TREM1 Protein
Recombinant Mouse CD354/TREM1 Protein is primarily known for its role in regulating inflammatory responses. Upon binding to its ligand, TREM1-L, the protein activates signaling pathways that lead to the production of pro-inflammatory cytokines, such as TNF-α, IL-1β, and IL-6. These cytokines play a crucial role in the recruitment and activation of immune cells, leading to an amplified inflammatory response. This activity is essential for the clearance of pathogens and the resolution of infections.

In addition to its role in inflammation, Recombinant Mouse CD354/TREM1 Protein has also been implicated in the pathogenesis of various diseases. Studies have shown that elevated levels of this protein are associated with inflammatory conditions, such as sepsis, rheumatoid arthritis, and inflammatory bowel disease. It has also been linked to the development and progression of certain types of cancer, such as lung cancer and acute myeloid leukemia.

Applications of Recombinant Mouse CD354/TREM1 Protein
Due to its critical role in regulating immune responses, Recombinant Mouse CD354/TREM1 Protein has several potential applications in both research and clinical settings. One of the main applications of this protein is in the study of inflammatory diseases. By using recombinant protein, researchers can manipulate the levels of CD354/TREM1 in cells and observe its effects on immune responses. This can help in understanding the underlying mechanisms of these diseases and identifying potential therapeutic targets.

In addition, Recombinant Mouse CD354/TREM1 Protein can also be used in the development of diagnostic tests for inflammatory diseases. Elevated levels of this protein in blood or tissue samples can serve as a biomarker for these conditions, allowing for early detection and treatment.

Furthermore, Recombinant Mouse CD354/TREM1 Protein has potential therapeutic applications. Studies have shown that blocking the activity of this protein can reduce inflammation and improve outcomes in animal models of sepsis and inflammatory bowel disease. This suggests that targeting CD354/TREM1 may be a promising approach for the treatment of these diseases in humans.

Conclusion
Recombinant Mouse CD354/TREM1 Protein is a critical regulator of immune responses, with a well-defined structure and activity. Its involvement in various inflammatory diseases makes it an important target for research and potential therapeutic applications. By understanding the structure and activity of this protein, we can gain valuable insights into the mechanisms of immune regulation and develop new strategies for the treatment of inflammatory diseases.

Recombinant Mouse CD354/TREM1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD354/TREM1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products