Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CIRBP Protein, N-GST

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P60824
Molecular weight:
45.30 kDa

Original price was: $287.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
Ala2–Glu172
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CIRBP Protein, N-GST

Product name ARO-P12744-100
Uniprot ID P60824
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE
Molecular weight 45.30 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Glu172
Aliases /Synonyms Cold-inducible RNA-binding protein, A18 hnRNP, Glycine-rich RNA-binding protein CIRP, Cirbp, Cirp
Reference ARO-P12744
Note For research use only.
Molecular Constructor
Ala2–Glu172
Product name ARO-P12744-1MG
Uniprot ID P60824
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE
Molecular weight 45.30 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Glu172
Aliases /Synonyms Cold-inducible RNA-binding protein, A18 hnRNP, Glycine-rich RNA-binding protein CIRP, Cirbp, Cirp
Reference ARO-P12744
Note For research use only.
Molecular Constructor
Ala2–Glu172
Product name ARO-P12744-50
Uniprot ID P60824
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence ASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE
Molecular weight 45.30 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala2-Glu172
Aliases /Synonyms Cold-inducible RNA-binding protein, A18 hnRNP, Glycine-rich RNA-binding protein CIRP, Cirbp, Cirp
Reference ARO-P12744
Note For research use only.
Molecular Constructor
Ala2–Glu172

Recombinant Mouse CIRBP Protein, N-GST

There are no reviews yet.

Be the first to review “Recombinant Mouse CIRBP Protein, N-GST”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products